KEGG   Nothobranchius furzeri (turquoise killifish): 107378888Help
Entry
107378888         CDS       T05163                                 

Gene name
sdha
Definition
(RefSeq) succinate dehydrogenase [ubiquinone] flavoprotein subunit, mitochondrial
  KO
K00234  succinate dehydrogenase (ubiquinone) flavoprotein subunit [EC:1.3.5.1]
Organism
nfu  Nothobranchius furzeri (turquoise killifish)
Pathway
nfu00020  Citrate cycle (TCA cycle)
nfu00190  Oxidative phosphorylation
nfu01100  Metabolic pathways
nfu01200  Carbon metabolism
Module
nfu_M00009  Citrate cycle (TCA cycle, Krebs cycle)
nfu_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
nfu_M00148  Succinate dehydrogenase (ubiquinone)
Brite
KEGG Orthology (KO) [BR:nfu00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    107378888 (sdha)
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    107378888 (sdha)
Enzymes [BR:nfu01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     107378888 (sdha)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: FAD_binding_2 Succ_DH_flav_C Thi4 Pyr_redox_2 GIDA FAD_binding_3 DAO HI0933_like
Motif
Other DBs
NCBI-GeneID: 107378888
NCBI-ProteinID: XP_015804845
LinkDB All DBs
Position
sgr05
AA seq 679 aa AA seqDB search
MATVRAASRLLSRRVLSRTKAVSHSSLVFSFKLQIVVGMLAVTTTLNELILFYFFMTQLI
SVAPQISTQYPVVDHEFDAVVVGAGGAGLRAAFGLSEAGFNTACVTKLFPTRSHTVAAQG
GINAALGNMEEDDWRWHFYDTVKGSDWLGDQDAIHYMTEQAPAAVVELENFGMPFSRTED
GRIYQRAFGGQSLKYGKGGQAHRCCCVADRTGHSLLHTLYGRSLRYDTSYFVEYFALDLL
MEDGECKGVIALCMEDGSIHRFRAQNTVIATGGYGRTFFSCTSAHTSTGDGNAMVTRAGL
PCQDLEFVQFHPTGIYGAGCLITEGCRGEGGILINSEGERFMERYAPNAKDLASRDVVSR
SMTIEIREGRGVGPDKDHVYLQLHHLPPQQLAMRLPGISETAMIFAGVDVTKEPIPVLPT
VHYNMGGIPTNYRGQVIDHVNGEDKVVPGLYACGEAASASVHGANRLGANSLLDLVVFGR
ACALTIAELHKPGEKLSPLRASAGEESVANLDKLRFADGSLRTSEIRLNMYKTMQNHAAV
FRTGPILKEGCDKMHDIYQTLDSIKTFDRGIVWNTDLVESLELQNLMLNAVQTIQGAEQR
KESRGAHAREDFKDRVDEYDYSKPLEGQQKKPFEQHWRKHTLSYVDHKTGKVTLKYRPVI
DSSLNEQDCAHVPPAIRSY
NT seq 2040 nt NT seq  +upstreamnt  +downstreamnt
atggcgactgttcgtgctgcgtctcgtctcctctccaggagagttctgtccagaacaaaa
gcagtgagtcacagtagcttggtattctcctttaagcttcagattgtggtagggatgctt
gcagttacaacgaccctaaatgaactgattttattttatttttttatgacacaactcatc
tctgtcgctcctcagatctccactcagtatccggttgtggatcatgagtttgatgcggtg
gttgtaggagcaggaggagctggacttcgggctgcttttggcttgtcggaggctggtttc
aacactgcgtgtgtcactaagctgttccctacccgctcacacactgtcgctgcgcagggt
gggatcaacgcagctctggggaacatggaggaggacgactggcggtggcatttctacgac
acagttaagggatctgattggcttggagaccaagatgctattcattacatgacagagcag
gctcctgctgctgtcgtagagctggagaactttggcatgccgttcagccgcacagaagat
ggtcggatctaccagagagcctttggaggtcagagtctgaagtacggaaaggggggccag
gctcaccgctgctgctgcgtggctgaccggacaggacactcactgctacacacgctttat
ggaagatcgcttcgttatgacactagctactttgtggagtactttgctctggacctgctt
atggaagatggagagtgtaaaggagtgattgctctctgcatggaggatgggtctattcac
cgcttcagagctcagaacaccgtcattgccactgggggttatggcaggacctttttcagc
tgcacatccgcccacaccagcacaggagacggaaacgccatggtgaccagagccggcctg
ccctgccaggatctggagtttgtgcagttccaccctactgggatctatggagcgggttgt
ctgatcactgagggttgtcgtggtgagggaggaatcctgatcaacagtgaaggagagcgt
ttcatggagcgttatgcaccaaacgctaaagacctggcctccagagacgtggtgtcccgc
tccatgaccatagagatcagagagggccggggtgttggtccagacaaggaccacgtgtac
ctgcagctccatcacctgcctcctcagcagctggccatgaggctgcctgggatctccgag
acagccatgatcttcgctggagtggacgtgactaaagagcccatccccgtcctacccaca
gtccactacaacatgggaggaataccgacaaactacaggggccaggtgattgatcatgtc
aacggcgaggacaaggtggtgcctggactgtacgcctgtggagaggcagccagtgccagc
gtgcatggagccaaccggctgggagccaactccctcctggacctggttgtgtttgggaga
gcctgcgccctcacaatcgctgagctgcacaaacccggagagaagctgagccctctgagg
gccagcgcaggggaggagtctgtggctaacctggacaagctcaggtttgctgatggaagt
ctgagaacctcagagatcagactaaatatgtataagaccatgcagaaccatgctgccgtg
ttccgtactggtccaattctcaaggagggatgtgataagatgcatgacatctaccagacc
ttagacagcatcaagacctttgatagaggcattgtgtggaacacagacctggtggaatcg
ttggagctgcagaacctgatgctgaacgccgtccaaaccatccagggagctgagcagagg
aaggagagcaggggagctcacgccagagaggacttcaaagatcgggtcgatgagtacgac
tactcaaagcccctggagggtcagcagaagaaaccctttgaacagcactggaggaagcac
acactctcatacgtcgaccacaaaactggaaaggtgacgctgaagtaccgtcctgtcatc
gacagctctctgaatgagcaggactgtgctcacgttcctcctgccatccgctcctactaa

DBGET integrated database retrieval system