KEGG   Nothobranchius furzeri (turquoise killifish): 107378988Help
Entry
107378988         CDS       T05163                                 

Gene name
aldh2
Definition
(RefSeq) aldehyde dehydrogenase, mitochondrial
  KO
K00128  aldehyde dehydrogenase (NAD+) [EC:1.2.1.3]
Organism
nfu  Nothobranchius furzeri (turquoise killifish)
Pathway
nfu00010  Glycolysis / Gluconeogenesis
nfu00053  Ascorbate and aldarate metabolism
nfu00071  Fatty acid degradation
nfu00280  Valine, leucine and isoleucine degradation
nfu00310  Lysine degradation
nfu00330  Arginine and proline metabolism
nfu00340  Histidine metabolism
nfu00380  Tryptophan metabolism
nfu00410  beta-Alanine metabolism
nfu00561  Glycerolipid metabolism
nfu00620  Pyruvate metabolism
nfu01100  Metabolic pathways
Module
nfu_M00135  GABA biosynthesis, eukaryotes, putrescine => GABA
Brite
KEGG Orthology (KO) [BR:nfu00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    107378988 (aldh2)
   00053 Ascorbate and aldarate metabolism
    107378988 (aldh2)
   00620 Pyruvate metabolism
    107378988 (aldh2)
  09103 Lipid metabolism
   00071 Fatty acid degradation
    107378988 (aldh2)
   00561 Glycerolipid metabolism
    107378988 (aldh2)
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    107378988 (aldh2)
   00310 Lysine degradation
    107378988 (aldh2)
   00330 Arginine and proline metabolism
    107378988 (aldh2)
   00340 Histidine metabolism
    107378988 (aldh2)
   00380 Tryptophan metabolism
    107378988 (aldh2)
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    107378988 (aldh2)
Enzymes [BR:nfu01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.3  aldehyde dehydrogenase (NAD+)
     107378988 (aldh2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Aldedh
Motif
Other DBs
NCBI-GeneID: 107378988
NCBI-ProteinID: XP_015805005
UniProt: A0A1A8U0P5
LinkDB All DBs
Position
sgr05
AA seq 517 aa AA seqDB search
MLRAVFYRAFLPLNRLSVCHYSSAIPAPNSQPEVHYNRLFINNEWHDAISGKTFPTVNPA
TGEVICQVAEADVADVDKAVKAARDAFRFGSPWRRMDASDRGLLLSRLADAIERDAAYLA
ELETLDNGKPYAVAFSVDVPMVIKCLRYYAGWADKWEGKTIPIDGDYFCYTRHEPVGVCG
QIIPWNFPLLMQAWKLGPALATGNTVVMKVAEQTPLTALYVASLIKEVGFPDGVVNIVPG
MGPTAGAAIAKHMDVDKVAFTGSTEVGHLIQQASGSSNLKRVTLELGGKSPNIILSDASL
EDAVEQSHFALFFNQGQCCCAGSRTYVQADVYDEFVERSVERARRRVVGNPFDLKTEQGP
QVDQEQFNKILGYISVGKREGAKLMCGGGVAADRGYFIQPTVFGDVQDNMTIAREEIFGP
VMQILKFKTLEEVITRANDTKYGLAAAVFTKDIDKANYLSNGLRAGTVWINCYDVFGAQA
PFGGYKASGNGRELGEYGLESYTEVKTVTIKVPQKNS
NT seq 1554 nt NT seq  +upstreamnt  +downstreamnt
atgcttcgtgcagttttttatcgagcttttcttcccctcaaccgactgtcagtctgtcac
tatagcagcgccatcccagcgcccaacagccagcctgaagtccactacaacaggctgttc
ataaacaatgagtggcatgatgctatcagtgggaaaaccttccctaccgtcaacccagca
acaggagaggtcatctgtcaagtagcagaggctgatgtggcagatgtagacaaggcagtg
aaggcagcacgtgatgccttcaggtttggttcaccgtggcgtcgtatggatgcttctgat
cgtggactgctgctcagtcgattggctgatgctattgagagggacgctgcctacctggct
gaactggagactctggacaatgggaagccttacgctgtggcctttagcgtggatgttccc
atggtgattaaatgtctcaggtactacgctggctgggctgataagtgggagggtaagacc
attcctattgatggagattacttctgctacaccagacacgaacctgttggagtctgtgga
cagatcataccgtggaacttccctctgttgatgcaagcctggaaattaggccccgccctg
gcgactggcaacaccgttgtgatgaaggtggcagagcagacgccactcacagccctttat
gtggccagtctcatcaaagaggtaggtttcccagacggtgttgtgaatattgtccctgga
atgggaccaacagctggagctgccattgccaaacacatggatgttgataaggtggccttt
actggatccacagaggttggtcatctgatccaacaggcttctgggagcagcaacctgaag
agagtcacgctagagctgggaggaaagagtcccaatatcatcctgtctgatgcttctttg
gaagatgcagtggagcagtcacactttgccctgttcttcaaccagggccagtgctgctgc
gctggatcccgaacgtacgtccaggcagacgtctacgatgagttcgtggagcgcagcgta
gagcgcgctaggagaagagtggtgggaaacccatttgacttaaagactgaacaaggccct
caggtcgatcaggagcagttcaacaaaattctgggctacatcagcgttggtaagagagaa
ggtgccaagctgatgtgtggaggaggagtagcagcagacagaggatacttcatccagccc
acggtgtttggagatgtccaagacaacatgaccattgccagggaagagatctttggtcca
gtgatgcagatcctgaagtttaaaacactggaggaagtaataacaagagctaatgacaca
aaatacggtttggcagcggctgtttttaccaaggacatcgacaaagccaactatttgtcc
aatgggctccgtgcaggaacagtctggataaactgctatgatgtgtttggggctcaggct
ccttttgggggctacaaggcttcaggtaacggcagagaactgggagagtacggcctggaa
agctacactgaagttaaaacggtgaccatcaaggtgccacagaagaactcgtag

DBGET integrated database retrieval system