KEGG   Nothobranchius furzeri (turquoise killifish): 107379696Help
Entry
107379696         CDS       T05163                                 

Gene name
setdb1
Definition
(RefSeq) histone-lysine N-methyltransferase SETDB1
  KO
K11421  histone-lysine N-methyltransferase SETDB1 [EC:2.1.1.43]
Organism
nfu  Nothobranchius furzeri (turquoise killifish)
Pathway
nfu00310  Lysine degradation
Brite
KEGG Orthology (KO) [BR:nfu00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00310 Lysine degradation
    107379696 (setdb1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:nfu03036]
    107379696 (setdb1)
Enzymes [BR:nfu01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.43  histone-lysine N-methyltransferase
     107379696 (setdb1)
Chromosome and associated proteins [BR:nfu03036]
 Eukaryotic Type
  Histone modification proteins
   HMTs (histone methyltransferases)
    HKMTs (histone lysine methyltransferases)
     107379696 (setdb1)
  Heterochromatin formation proteins
   Other heterochromatin formation proteins
    107379696 (setdb1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: SET Tudor_4 DUF5604 TUDOR_5 Pre-SET MBD PLU-1 DUF4537 Peptidase_S46
Motif
Other DBs
NCBI-GeneID: 107379696
NCBI-ProteinID: XP_015806056
UniProt: A0A1A8UBC7
LinkDB All DBs
Position
sgr05
AA seq 1224 aa AA seqDB search
MMEISERMEVDGWDSSLEDDLGVSLDDLKKLVEEAVEQSEMVQKKKAQLKELKQWVEQKE
EEEAKTEMLLKDTNQSLKRCEKLVKEAYQLNGLVYRESSSEDEGGGDGLCSEVIEIDDDD
DDDVIAVGCLVPPTKSPGKDSVLKEASAVLQKTSQQVQKLTQMVGKPSPGAPQSLIQVSA
PTIFVSQASSQGTTPPSSSLKKFDLRIGMNILGKKRTKTWHKGTLVAINPIGNGVYKYKV
RFDKGKSLLSGNHVAFDDNPAMEDLFVGARVVARYKDGSLTWLYAGIVAEMPNNKNRMRY
LIFFDDGYASYVILPEVYPVCKPLKRTWEDIEDASCRDFIEEYISAYPSRPMVLLKVGQI
IKTEWEGTWWKSKVEEVDGSLVKILFLEDKRSEWIYRGSTRLEPMFNLKMTSANTQEKKL
AGHQRTRPNMGVLRSKGPVVQYTGVEHAGSSSVPPSQPAATPQLQQRPQPIQPQQPPQIQ
QTPPPSQTIQPQRIENKHQMAKKSTSPFIPGVGGTHASKILQTLSPTSSNLSGKVMAIPN
ASTSQPSVTVSYQRQPSVAPPPPPVTHAMAVIPTQPAYRAPTDRIFYMPHVCQPACLKRI
RPVKPDKHRGKNPLLTPLLYDFRRMTSRRKINRKVSFHVTYKAPCGLCLRKMSEIQTYLF
QTRCDFIFLEMFCLDPYVLVDRPFQPQRPFYYIPDITSGKEDIPLSCVNEIDTTPPPKVA
YSKERIPEDGVVINTSSDFLVGCDCTDGCLDKSKCSCHQLTLQATGCTPGGLINQNAGYL
YKRLEECLPTGIYECNKRCKCCAQMCTNRLVQHGLQVRLQLFKTQNKGWGIRCLDDIAKG
SFVCIYAGKILTDDFADKEGLEMGDEYFANLDHIESVENFKEGYESEAHCSDSEGSGVDV
SRIKIQPSSLATGNTAAQLSKKGRSLSSSDDSNGEGDKDSKSDDESDSSDDTFVKDNYYS
SSSVWRSYTTRGQLKGNKEGSQDSKDGMSVSGGAASEKPPSIPVEMGKSKVASWLTSQGL
KKDTEDKSQMKSDASKRQDVMTLSDSDDVQTISSGSEDNKEKEKPAPVSGPSVTKKQVAV
KSTRGIALKSHSMMVKTGASGGGAGPSGQGGKAGNQGTPGESGDSGPKNTRLFFDGEESC
YIIDAKLEGNLGRYLNHSCSPNLFVQNVFVDTHDLRFPWVAFFASKRIRAGTELTWDYNY
EVGSVEGKELLCCCGSTECRGRLL
NT seq 3675 nt NT seq  +upstreamnt  +downstreamnt
atgatggagatcagcgagcgaatggaggtggacggctgggactcgagtctggaggacgat
ttgggtgtttccttggatgatctgaagaagctggttgaagaagctgtggaacagagtgag
atggtgcagaagaaaaaagctcagttgaaagaactgaagcagtgggtggaacagaaagag
gaagaggaggcaaagacggagatgcttctcaaagacacaaaccaatctttaaagaggtgt
gagaaactggtaaaggaggcttatcagctgaacggtcttgtctaccgagagagcagctct
gaggatgaagggggtggagatggactgtgctctgaagtcattgagatagatgatgatgac
gatgacgatgtcattgcagttggatgtttggttcctccaacgaaatctccaggcaaagac
tcagtgttaaaagaagcttctgcagttctccagaaaacctcccagcaggtgcagaagttg
acccaaatggtgggcaaaccttcaccaggagctcctcagtcactcatccaggtttcagca
ccgacaatatttgtatcgcaagcttcgtctcaagggacgaccccgccgagctcgagcttg
aaaaaatttgatctccggatcgggatgaacatcctgggaaagaaacgcaccaagacatgg
cacaaaggaaccctcgtggctatcaaccctattggaaacggtgtttataaatacaaagtg
aggtttgataaaggcaagagtttgctgtccgggaatcacgtggcttttgacgacaacccg
gctatggaggacctgtttgtcggggctcgtgtcgtcgccaggtacaaagacggaagcctg
acgtggctctacgcgggaatcgtggcagagatgcccaacaacaaaaaccgcatgaggtat
ttgattttcttcgacgacggctatgcttcatatgtgatactgcctgaagtctacccagtg
tgcaaaccgctgaagcgtacttgggaagacatagaggacgcgtcgtgtcgagacttcatc
gaggagtacatttctgcctaccccagcaggccgatggtgctcctaaaggtcggccagatc
atcaagaccgagtgggaggggacttggtggaagagcaaagtggaggaagtggacggcagc
ttggtcaaaattctctttttggaagataaaaggagcgagtggatttacagaggatccacc
agattagagcccatgttcaatctgaaaatgacttcagcaaacacacaagagaagaaactg
gccggccaccagcggaccagaccaaacatgggagtgcttagaagtaaaggcccagtggtt
cagtacactggcgttgaacatgctggaagttcttctgttcctcccagtcagcctgctgcg
acaccacagcttcagcagcgtcctcagcccattcagccccagcagcctcctcagatccag
caaacgcctccgccctcacaaaccatacagcctcagcgcatcgagaataagcatcagatg
gcaaagaagagcacatctccatttatccctggggttggaggaacacatgcctccaaaatc
ttgcagactttgtcccccacttccagcaacctcagcggaaaagtgatggctattccgaat
gcctctacgtcccaaccctctgtcaccgtttcctaccagagacagccctctgtggctcct
ccccctccacctgtgacccacgccatggccgtaattcctacacagcccgcctaccgagcc
ccgactgaccgcatcttctacatgcctcacgtgtgtcagcccgcttgtctgaaacgaatc
cggccggtgaaaccggacaagcatcgagggaaaaaccccctcctcacacccctgctctat
gattttagacgcatgacgagtcgacgcaaaatcaaccgaaaggtgtcttttcacgtgacg
tacaaggctccatgtggtctctgtctccgtaagatgtcagagatccagacctacctcttc
caaacccgctgtgacttcatattcttagaaatgttctgtctcgacccctacgtgctggtt
gatcggcctttccagccacaaaggccgttttattacattccagacatcaccagtggaaag
gaggacatcccgctgtcctgcgtcaatgagatcgacaccaccccccctcctaaagtagcc
tacagtaaagaacgtattcctgaagacggcgtggtcatcaacaccagttctgatttcctg
gtggggtgtgattgcacggacggctgtctggacaagtccaaatgttcctgccaccagctg
acgctgcaggctacaggctgcacacccgggggactgatcaaccaaaacgcgggatattta
tacaagcgattagaggagtgcctgcctacagggatctacgagtgtaataaaaggtgcaaa
tgctgtgctcagatgtgcacaaatcggctggtgcagcacggtctgcaggtccgcctccag
ctctttaagactcagaacaaaggctggggcatccggtgcttggatgatatcgctaagggc
tcgtttgtctgcatttatgccggtaaaatcctgactgatgacttcgctgacaaagaaggc
cttgaaatgggcgatgagtatttcgccaacctggaccacatagagagcgtggagaacttt
aaggagggctatgagagcgaggcgcactgctcggacagcgaggggagcggagtggatgtg
tccagaatcaaaatccagccgtcctctttggccactggaaacacggccgcacaactttct
aaaaaaggccgaagcttgagctcatcagacgacagcaacggggaaggcgacaaagactcg
aagagcgacgatgaaagcgacagttcagacgacacgtttgtgaaggacaactactactcg
tccagttcggtgtggaggagttacaccacgcggggtcagctcaaaggcaacaaggaaggg
agtcaggatagcaaagatggaatgagcgtttcaggaggggcagcttctgagaagccccca
tcgataccagtggagatggggaaaagcaaagtggcttcctggctaacgagccaggggctg
aagaaggacactgaagacaaaagtcaaatgaagtctgatgcatccaagaggcaggatgtg
atgacgctgtctgacagcgatgacgttcagactatcagctcaggatcagaggacaacaag
gaaaaagaaaaacccgctccagtttctggccccagcgtgaccaaaaagcaagtggctgtg
aaatccacccgaggcatcgccctgaagagccacagcatgatggtgaaaacgggagcatcc
ggaggaggggcggggccaagcgggcaaggagggaaagctggaaatcagggaacgcccgga
gaaagtggcgacagcggtcccaaaaacacccggctgttcttcgacggggaggaatcctgt
tacatcatcgacgcaaagttggaggggaatcttgggcgatatcttaatcacagctgcagc
ccaaacctttttgtccagaatgtgtttgtggacacacacgacctgcgattcccctgggtg
gccttctttgccagcaagcgtatccgggccggcaccgagctgacctgggactacaactat
gaggtggggagtgtggagggtaaagagctgctgtgctgctgcgggtccacagagtgcaga
ggaaggctactgtga

DBGET integrated database retrieval system