KEGG   Nothobranchius furzeri (turquoise killifish): 107379803Help
Entry
107379803         CDS       T05163                                 

Gene name
wbscr17
Definition
(RefSeq) putative polypeptide N-acetylgalactosaminyltransferase-like protein 3
  KO
K00710  polypeptide N-acetylgalactosaminyltransferase [EC:2.4.1.41]
Organism
nfu  Nothobranchius furzeri (turquoise killifish)
Pathway
nfu00512  Mucin type O-glycan biosynthesis
nfu01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:nfu00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00512 Mucin type O-glycan biosynthesis
    107379803 (wbscr17)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01003 Glycosyltransferases [BR:nfu01003]
    107379803 (wbscr17)
Enzymes [BR:nfu01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.41  polypeptide N-acetylgalactosaminyltransferase
     107379803 (wbscr17)
Glycosyltransferases [BR:nfu01003]
 O-Glycan biosynthesis
  Mucin-type
   107379803 (wbscr17)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glycos_transf_2 Ricin_B_lectin RicinB_lectin_2
Motif
Other DBs
NCBI-GeneID: 107379803
NCBI-ProteinID: XP_015806209
LinkDB All DBs
Position
sgr06
AA seq 547 aa AA seqDB search
MSCVMNSPVHSSCDERGIRLIFSPLLCTGLSKSLGLIEGFGGRGEGGLPATLSPLEENDA
KYLREKYGYNAYLSDRISLDRTTPDHRPNKCRKASYPRDLPQISLIFIFVNEALSVILRS
VHSAVNHTPAHLLKEIILVDDNSDDEQLKGPLEEYVNKRYPGLVKIVRNQKREGLIRARI
EGWKVATAEVTGFFDAHVEFTPSWAEPVLARIREDHKRIILPSIDNIKHDTFEVERYENS
GHGYNWELWCMYINPPKQWWDEGDMSAPIRTPAMIGCSFVTNRDYFGELGLLDSGMDVYG
GENIELGIRVWLCGGSMEVLPCSRVAHIARIKKPYHSNIVFHMRRNALRVAEVWMDDYKS
NVYLAWNIPMENHGIDYGDVSQRVSLRKSLQCKSFKWYLDNVYPEMRRYNNTLFYGEIRN
AKVSHLCMDQGVKENHTATLHPCHGWGSQLGRYTKDGRLFLGPLGSTGEDTRCVVDDQLS
SFPQLLDCDKVTNVRQKMWSFSQNDSITNRATGRCLEVVPANVYFGHLLVLQPCSGQRWT
IKNSMKQ
NT seq 1644 nt NT seq  +upstreamnt  +downstreamnt
atgagttgtgtgatgaattcaccagttcattcatcctgtgatgagagaggcatcagactt
atcttctcgcctttgctttgcacaggtctgtccaaatccctgggcctgatcgagggcttc
gggggtcggggggaaggaggccttcctgccacgctttccccgcttgaggagaatgacgct
aaatacctgagagagaagtacggctacaacgcctacctcagtgacagaatctccctggat
cggaccacaccagaccaccggcccaacaaatgcagaaaagccagctacccgagagacctc
ccccagatctccctcatcttcatctttgtcaacgaggctctttcagtgatcctgcgatcc
gtccactcagctgtcaatcacacgccggctcacctgctgaaggagatcatcctggtggac
gacaacagcgacgacgagcagctgaaaggcccgctggaggagtacgtgaacaagcgctac
ccgggtctggtaaagatcgtacggaaccagaagagagaggggctgatccgggccaggatc
gagggctggaaggtggccactgctgaagttacgggcttttttgatgctcatgtggagttt
actccctcttgggccgagcccgtactcgccaggatcagagaggaccacaagcgaatcatc
ctgccctccatcgacaacatcaagcacgacacctttgaggtggagcgctacgagaactcg
ggccatggctacaactgggagctgtggtgcatgtacatcaacccgcccaaacagtggtgg
gacgagggcgacatgtctgctcccatcagaactcctgccatgattggctgctccttcgtg
accaaccgggactactttggagagctaggtctactggactcgggcatggacgtctacggg
ggcgagaacatagagctgggcatcagggtgtggctgtgcggaggcagcatggaggtgctg
ccttgctccagggtggctcacatcgccagaataaagaagccgtaccacagcaacatagtg
ttccacatgcggcgtaacgctctgcgtgtggcggaggtctggatggatgactacaagtct
aacgtatacctggcctggaacatccctatggagaaccatggcatcgattatggagacgtg
tcccagagggtgtctctgaggaagagtctgcagtgtaagagctttaagtggtacctggac
aacgtttacccagagatgaggaggtacaacaacacgctgttctacggcgagatccgtaac
gctaaagtgagccacctgtgcatggatcaaggcgtgaaggagaaccacaccgccacgctg
cacccgtgtcacggctggggttctcagttgggacgatacaccaaagatggccggctgttc
ctgggtccacttggcagcactggggaggacactcgctgtgtggtggacgatcagctcagc
agcttcccacagctcctcgactgcgacaaagtgacaaacgtcagacagaaaatgtggagt
ttctcccagaacgactccatcactaaccgagccacaggacgctgcctggaggtggtaccg
gccaacgtttacttcggccacctgctggtgctgcagccctgctcgggtcagaggtggacc
atcaagaacagcatgaagcaataa

DBGET integrated database retrieval system