KEGG   Nothobranchius furzeri (turquoise killifish): 107381436Help
Entry
107381436         CDS       T05163                                 

Gene name
gys2
Definition
(RefSeq) glycogen [starch] synthase, liver
  KO
K00693  glycogen synthase [EC:2.4.1.11]
Organism
nfu  Nothobranchius furzeri (turquoise killifish)
Pathway
nfu00500  Starch and sucrose metabolism
nfu01100  Metabolic pathways
nfu04910  Insulin signaling pathway
Module
nfu_M00854  Glycogen biosynthesis, glucose-1P => glycogen/starch
Brite
KEGG Orthology (KO) [BR:nfu00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    107381436 (gys2)
 09150 Organismal Systems
  09152 Endocrine system
   04910 Insulin signaling pathway
    107381436 (gys2)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01003 Glycosyltransferases [BR:nfu01003]
    107381436 (gys2)
Enzymes [BR:nfu01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.11  glycogen(starch) synthase
     107381436 (gys2)
Glycosyltransferases [BR:nfu01003]
 Polysaccharide
  Storage polysaccharide
   107381436 (gys2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glycogen_syn Glyco_transf_5 Glyco_transf_4 Glycos_transf_1 Glyco_trans_1_4
Motif
Other DBs
NCBI-GeneID: 107381436
NCBI-ProteinID: XP_015808594
LinkDB All DBs
Position
sgr01
AA seq 705 aa AA seqDB search
MPLPRSLSMTSLSGLLPAWEEDELPVEDLLLFEVAWEVTNKIGGIYTVIQSKAKITVDEW
GENFYMMGPYFEHNFKTQVEGCDPPNAAVRKAMDALIHNGCQVHFGRWLIEGSPFVILFD
INSAAWNLDRWKGDLWEACHIGLPFHDREANDSLILGSLIAWFFKELTDHLGDKPNVIAH
FHEWQAGPGLVLSRTRKIPMATVFTTHATLLGRYLCAGNADFYNNLDKFNVDKEAGQRQI
YHRYCLERAAVHCAHVFTTVSQITAVEANHMLHRKPDVVTPNGLNVKKFSAMHEFQNLHS
TSKTRIQEFVRGHFYGHLDFNLDKTLFFFIAGRYEFSNKGADIFLESLSRLNYLLRVHKN
DVTVVVFFIMPAKTNNFNVESLKGQAVRKQLWDTAHTVKEKFGTKLYDALLKGQMPDMNS
ILDRDDFTIMKRAIFATQRQSLPPVTTHNMLEDATDPILSSVRRTGLFNSRNDRVKIIFH
PEFLSSTSPLLPMDYEDFVRGCNLGVFPSYYEPWGYTPGECTVMGIPSVTTNLSGFGCFM
EEHVSDPAAYGIYIVDRRFRSPEESCNQLTQFMFSFCQQSRRQRIIQRNRTERLSDLLDW
RYLGRFYIYARHLALSRSFPDKFNMDPKAPLKTEGFRYPRPSSVPPSPSASLHSTPHHSD
AEDDDDDEPYNEDEEAERDRLNIKTPFVLGDVPEGKKKQPGESGN
NT seq 2118 nt NT seq  +upstreamnt  +downstreamnt
atgccgttgccccgttccctgtccatgacgtccctgagcgggctgctgccggcttgggag
gaggacgagcttcccgtggaagacctgctgctgtttgaagtggcctgggaggtcaccaac
aagattggaggcatttatacggtcatccaatccaaggcgaagatcacagttgatgaatgg
ggggagaacttctacatgatggggccgtactttgagcacaactttaagactcaggtggaa
ggttgtgatccgcctaacgctgctgtcaggaaggccatggatgctctgattcacaatggc
tgccaggttcactttggccgctggctgattgagggtagccccttcgtgattctgtttgac
atcaactcagctgcatggaatctggaccgctggaagggggacctgtgggaggcctgccac
atcggcttgccgtttcatgacagagaggccaacgactccctcatcctgggctccttgatc
gcctggttcttcaaagagttaacagaccaccttggagacaagcccaacgtcattgcccac
ttccatgagtggcaggcaggccctggtctcgttttgtctcggacccggaagattcccatg
gccacggtcttcaccacacatgccactctgctgggaagatatctttgtgctggaaatgcg
gacttttacaacaacctggataagttcaatgttgacaaagaggcaggacaaaggcagatc
taccatcgatactgcctggagcgagcagcagtgcactgtgctcatgtcttcaccaccgtg
tcccagatcaccgctgtggaagccaaccacatgctgcacaggaaaccagatgtggtgaca
ccaaatgggctgaatgtgaaaaaattctcagccatgcatgagtttcagaacctgcactcc
accagtaagacccgcatccaggaatttgtccgtggacacttctatgggcatcttgacttc
aacttagataaaaccctgttctttttcatcgctggacgctacgagttctccaacaaagga
gctgatatcttccttgaatcgctgtccagactcaactatttgctgcgggttcacaaaaat
gatgtgacagtggtagttttcttcatcatgccggctaaaaccaacaacttcaacgtggag
tcactaaagggccaagcagtccgcaaacagctgtgggacacagcacacactgtaaaggag
aagtttggtacgaagctctacgatgctttgctgaaagggcagatgcctgacatgaactcc
attctggaccgagatgacttcactattatgaaaagagccatctttgccactcagagacag
agtcttcctccggtgaccacgcacaacatgctggaggatgccacagatcccatcctgtcc
agtgtcagacgcaccggcctctttaactctaggaatgaccgtgtgaagatcatcttccac
cctgagtttctgtcctccacaagtcctctgttaccgatggactatgaggactttgtccgc
ggctgtaaccttggagtgtttccttcctactatgaaccatggggatatacacctggtgag
tgtactgttatgggcattcccagtgtgaccaccaacctgtcaggttttggctgttttatg
gaggagcatgtgtcagaccctgcagcctacggtatttacattgttgaccgacggttccga
tcacctgaagagtcgtgtaaccagctgacccagtttatgttcagcttttgccagcagtct
cggcgtcagcgcattatccagcggaaccgcactgagaggctgtccgatctgctggactgg
agataccttggaaggttctacatatacgcacgccatctggctctcagcaggagttttcca
gacaagttcaacatggatcccaaagctcctctgaagacggagggtttccgttaccctcga
ccctcctccgtgcccccctctccctctgcttccctccactccactccccaccacagtgat
gcagaggatgatgatgacgatgaaccatataatgaagatgaggaggctgagagggaccgg
ctgaacatcaagactccgtttgttctgggagacgttccggagggcaagaagaagcagcct
ggagagtcaggaaactga

DBGET integrated database retrieval system