KEGG   Nothobranchius furzeri (turquoise killifish): 107381531Help
Entry
107381531         CDS       T05163                                 

Gene name
kmt5b
Definition
(RefSeq) histone-lysine N-methyltransferase SUV420H1
  KO
K11429  histone-lysine N-methyltransferase SUV420H [EC:2.1.1.43]
Organism
nfu  Nothobranchius furzeri (turquoise killifish)
Pathway
nfu00310  Lysine degradation
Brite
KEGG Orthology (KO) [BR:nfu00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00310 Lysine degradation
    107381531 (kmt5b)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:nfu03036]
    107381531 (kmt5b)
Enzymes [BR:nfu01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.43  histone-lysine N-methyltransferase
     107381531 (kmt5b)
Chromosome and associated proteins [BR:nfu03036]
 Eukaryotic Type
  Histone modification proteins
   HMTs (histone methyltransferases)
    HKMTs (histone lysine methyltransferases)
     107381531 (kmt5b)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: SET DUF3970 DUF4746
Motif
Other DBs
NCBI-GeneID: 107381531
NCBI-ProteinID: XP_015808737
UniProt: A0A1A7ZJY5
LinkDB All DBs
Position
sgr07
AA seq 860 aa AA seqDB search
MKWLGESKNMVVNGRRHGSKLTSEQPVSQTRSQHPQRASQRQNRSHPRNRRCSRRCNAAS
LEAERRYVPSSGMTAKELCENDDLTTSLILDPYLGFQTHKMNTRFRPIKGRQEELKEIIE
RFKKHDNLEKAYKALMSGDWCRNVFLHKSKAQEKLFKQHVFVYLRMFAADSGFEILPCNR
YSSEQNGAKIVATKEWKRNDKIEYLVGCIAELSESEENMLLRHGENDFSVMYSTRKNCAQ
LWLGPAAFINHDCRPNCKFVSTGRDTACVKVLRDTEPGEEISCYYGDGFFGENNEFCECY
TCERRGTGAFKSKAGLPAEVPVINSKYGLRETDKRLNRLKKLGEGNPSSDSHSVGSHTDV
DSQENPKTHQSARNRSSSSGLKYKNRTQSRQMLSRALSTSCSKQGRVNNNRVPKRLRSKP
SLSSVRLRSRRRGAEPKASAKSEAVQVGLRDSKVSLCKGIAVKEEDGSDLVVLGQKGCLT
RHAAKENGSLPAVESSEGSQCSAYRTRRSTRTLVKAQELATGVKLEPSAMDGLSPVPGGV
VIKTEPADMDEYLHQGSGLQQPVFDASYTRKSARTSRKRPAWLRTERTIKCAGSNCEPFS
PVAASRASNFSDCGNVLLSFADRHRDLNGTANSSKALRRDKGKSSCRSQDKAKKKRRITR
YDAQLILENNTGIPKLTLRRRRDSSSSKTNDPSEHVGSSTVNSASSSKISIKFSKDHDKD
KGSSYIAKLNNGFAPVVHSNATKLKIQLKREDDARRIAQSKMETMSYNRDMAQSLESRNG
GHRTQKVLAETSSDEDEEEGEEEEENDVDEDDDDYFHNEFEDDFIPLPPAKRLRLIVGKD
SIDIDISSRRREDQSLRLNA
NT seq 2583 nt NT seq  +upstreamnt  +downstreamnt
atgaagtggctgggcgaatccaagaacatggtagtaaatggcagacgacacggaagcaag
ttgaccagcgagcagcctgtgagtcagactcgctctcagcacccccagcgagcgtctcag
cgccagaacagaagccacccaagaaaccgaagatgtagccgccggtgtaatgctgctagt
ctggaggcggagcggcgttacgtgccctcctcaggaatgactgctaaggagctgtgtgag
aacgacgatctgaccaccagtctcattctggatccgtatctgggctttcagactcacaaa
atgaacaccaggtttcgaccaatcaagggaagacaagaggagctgaaggagatcatcgag
cgcttcaaaaagcacgacaacctggagaaagcttacaaagctctgatgtctggagactgg
tgcaggaatgtttttcttcacaagtccaaggctcaagaaaagctcttcaagcagcatgtg
tttgtttatctgcgaatgtttgctgctgacagcggcttcgagattctgccctgtaatcgc
tattcctcggagcagaatggagccaaaatagtggccacaaaggaatggaaaagaaacgat
aagatcgagtatctggtgggctgcatcgctgagctgtccgagagcgaggagaacatgctc
ctcagacacggcgagaacgatttcagcgtcatgtactccacgcgcaagaactgtgctcag
ctgtggctcgggcccgcagccttcatcaatcatgattgtcgaccaaactgcaagtttgtg
tcgacggggcgggacacggcctgcgtgaaggttctgagggacacggaaccaggagaggaa
atttcatgttactatggagacgggttctttggagaaaacaatgagttttgtgaatgttat
acgtgtgaaagacgaggaactggagcgttcaaatccaaagctgggcttccggcggaggtc
ccggtgatcaacagcaagtacgggctgcgggaaactgacaagcgtctgaacaggctgaag
aagctgggagaaggaaatccaagctcagacagtcactctgtgggctcccacaccgacgtg
gactctcaggaaaatccaaaaacacatcaatctgccagaaacagatcgtcgtcatctggc
ctgaagtataaaaacaggactcagagcagacagatgttgtcccgagccctctctacctca
tgttccaaacaaggtcgtgtaaacaataacagggtaccaaagagactaaggtccaagccg
tcgctcagcagtgtccggctgcggagtcgtaggaggggggcggagcctaaagcatcagcc
aaatccgaggctgtccaggtgggcctcagggactcgaaggtgtctctgtgtaaaggcatt
gctgtcaaggaggaagatggatcggacctagtggttctgggccagaaaggctgcctgacc
cggcacgccgccaaggaaaatggtagtcttccagccgtggagagcagcgagggcagccag
tgttccgcttacaggactcgcaggtccactcggaccctcgtgaaggcccaggagctggcc
actggggtcaaactagagcccagtgccatggacggtttgagcccagttcctggcggagtg
gtcatcaaaaccgagcctgctgacatggacgagtacctccaccaaggatctggactgcag
cagccggtgtttgatgccagctacaccagaaaaagtgcacgcaccagccggaaacggcca
gcttggcttcggacagagcggacgattaaatgtgcgggctcaaactgtgagccgttctca
ccggtggctgcaagccgtgcctccaacttctcagactgtggcaacgtgttgctgagcttc
gccgacagacacagagacttaaacggcaccgccaacagcagcaaggcgctccgcagggac
aagggcaagagcagctgccgctcacaggacaaggcgaagaagaagcgtcgcatcacgcgg
tatgatgctcagctgatcctggaaaacaacacgggcatcccaaagctgacactccgccgg
cggagggacagcagcagtagcaagaccaacgaccccagcgagcacgtcggctcttccacc
gtcaactctgcctcttccagtaaaatcagcatcaagttcagcaaagaccacgacaaggac
aagggtagctcctacatcgccaagctgaataacggctttgcgccagtggtccacagcaac
gccaccaagctgaagatccagctaaagagggaggacgacgctcgcagaatagcccagagc
aagatggagaccatgtcttacaatagagacatggctcagagcctagagagtaggaacggt
ggacatcggacccagaaggtcctggcagaaacatcttctgatgaagatgaggaggaagga
gaggaggaggaggagaacgatgttgacgaagatgacgacgactacttccacaatgagttt
gaggacgatttcattccacttcctccagcaaaacggctgcgactcatcgtgggtaaagac
tccatagacatcgatatctcctccaggaggagagaagaccagtctctgaggctgaacgcg
tga

DBGET integrated database retrieval system