KEGG   Nothobranchius furzeri (turquoise killifish): 107381713Help
Entry
107381713         CDS       T05163                                 

Gene name
mapk6
Definition
(RefSeq) mitogen-activated protein kinase 6
  KO
K06855  mitogen-activated protein kinase 4/6 [EC:2.7.11.24]
Organism
nfu  Nothobranchius furzeri (turquoise killifish)
Brite
KEGG Orthology (KO) [BR:nfu00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:nfu01001]
    107381713 (mapk6)
Enzymes [BR:nfu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.24  mitogen-activated protein kinase
     107381713 (mapk6)
Protein kinases [BR:nfu01001]
 Serine/threonine kinases: CMGC group
  MAPK family [OT]
   107381713 (mapk6)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr APH
Motif
Other DBs
NCBI-GeneID: 107381713
NCBI-ProteinID: XP_015809025
UniProt: A0A1A8UV11
LinkDB All DBs
Position
sgr07
AA seq 757 aa AA seqDB search
MAEKFESLMNIHGFDLGSRYMDLKPLGYGGNGLVFSAVDTDCDKRVAVKKIILTDPQSVK
HALREIKIIRRLDHDNIVKVFETLGPCGRRLTEDVASLTEVNSVYIVQEYMETDLCQLLE
RGPMSEGHARLFMYQLLRGLKYIHSANVLHRDLKPANLFVNTEDLVLKIGDFGLARIMDP
HYSHKGHLSEGLVTKWYRSPRLLLSPNNYTKAIDMWAAGCIFSEMLTGKTLFAGAHELEQ
MQLILESIPVLREEDRQELHSVIPVFIRSDMSKPHTPLAKLLPDISPQALDFLEKILTFN
PMDRLTAEEALAHPYMADYSFPLDEPVSLHPFHIEDEVDDILLMDQSQSHTWEQYHESQF
SEADWHLHSTHDPDEVQVDPRALSDVTDEEEVQIDPRKYTDGDREKFMDEPSFDYSSRHP
SERSWQEDHHENKYCDVQCSHTCNYKAVSPSYLDNLIWRDSEVNHYYEPKLIIDLSNWKE
QQSKEKADRKAKSKCEKNGLVKAQIALKEAEKTQSHAEKDSAQEKHQTERPQSQQNQGFD
FDSFIASTIKLSLQPEPCQEVTLLSEVGLLNELNFSVSQLEAPRPSSVSKTISQEKEEKC
LVNLAQLGGGGLGVVAADCVWPAKPWENFSSGEIVGENGCLIDEACWDIRNVDHFQKEST
YTSYLDHLFSRKEEGVAETVTSSEMEPSVVKELDDGFLDSSAEIVFNMQLDTLALPGFDS
PDDLPLKSIQASLTPCAVKCSPQIAHKTYSSIFKHLN
NT seq 2274 nt NT seq  +upstreamnt  +downstreamnt
atggcagaaaagtttgagtcattgatgaatatccatggctttgacctgggatctcgctac
atggacttgaagcctctgggctatggaggaaacggcctggtgttttcagcggtcgacact
gactgtgacaagcgtgtagctgtgaagaaaattatcttgactgatccccagagtgtcaag
catgccctgcgggaaatcaagataattcgacgacttgatcacgacaacattgtcaaggtg
tttgagaccctaggcccctgtggtcgcaggctaacagaagatgtggcatcgctgacagag
gtaaactctgtctacattgtacaggagtacatggagacagacctctgtcagctgctggag
cgaggccctatgtctgaaggccacgccaggctcttcatgtaccaactcctaaggggccta
aagtacatccactctgccaatgtgctgcaccgtgacctcaagcctgccaacctgtttgtt
aacacagaggacctagtacttaagattggggactttgggttggcccgcatcatggatcct
cactactctcacaagggccatctctctgaaggtctcgtcacaaagtggtaccgatctcca
cggctgctgctgtctcctaacaactacaccaaagctatcgacatgtgggcggctggatgc
atcttttctgaaatgctcactgggaaaacactctttgcaggagcacatgagcttgagcaa
atgcagctgatcctggaatccatccctgttctgagagaggaggatcggcaagagctccac
agcgtcatccctgtcttcattcgcagtgacatgtcaaagcctcacactccgctggccaag
ctgttgcctgacattagtccacaggccctggattttctggagaagatcctcacctttaac
cccatggatcgcctgactgcagaggaggccctggcccacccctatatggctgactactcc
ttccccttggatgagcccgtctctctgcacccctttcacattgaggatgaagtagatgat
atcctgctcatggatcagagccagagccacacctgggaacaataccacgagagccagttc
tcagaggctgattggcacttgcacagcacccatgacccagatgaagttcaggttgatcca
agagctctctctgatgtcacagatgaagaggaagtacagattgatccacggaaatacacc
gatggagatcgagagaagtttatggacgagccatccttcgattactcaagtcgccatcca
tcagagcgatcttggcaggaagaccatcatgagaataaatactgtgacgtgcagtgtagc
cacacctgcaactacaaggctgtgtcaccctcctatttggacaacctcatctggagggac
agtgaagtcaaccactactacgaacccaagctcatcatcgacctctccaactggaaagag
cagcagagcaaggagaaggcagaccgcaaggccaagagcaagtgtgagaagaatgggctt
gttaaagcccagattgctctgaaggaggctgagaagacccagagccatgcagagaaggac
agtgcacaagaaaaacaccagaccgaaagacctcaaagtcaacagaaccaaggctttgac
tttgactccttcattgccagcaccattaaactgagcctgcaacctgagccctgtcaggag
gtgactttgctcagcgaagtaggccttctgaatgagctcaacttttctgtctcccagctg
gaggctcctcgccccagctccgtatcaaagaccataagtcaggagaaggaagagaagtgc
ctggtaaaccttgcccagttaggcggaggtggtttaggggttgttgcagcagactgcgtt
tggcccgctaagccctgggaaaacttcagctccggggaaatagtcggggagaatggatgt
ctgatagatgaagcatgctgggacattcgtaacgtggaccacttccagaaggagagcact
tacaccagctacctggaccacctgttcagccgcaaagaggagggagttgcagagactgtg
accagttctgagatggagccctcagtggtgaaagagctggatgacggcttcctggacagt
agtgcagagattgtgtttaatatgcagctggacactctggccctgcctggctttgacagc
cccgatgacttgcctctaaaatccatccaggcttccctcacaccttgcgctgtcaaatgc
tctccacaaatcgctcacaaaacctacagcagcatcttcaagcatcttaattaa

DBGET integrated database retrieval system