KEGG   Nothobranchius furzeri (turquoise killifish): 107381906Help
Entry
107381906         CDS       T05163                                 

Definition
(RefSeq) uncharacterized protein LOC107381906
  KO
K00844  hexokinase [EC:2.7.1.1]
Organism
nfu  Nothobranchius furzeri (turquoise killifish)
Pathway
nfu00010  Glycolysis / Gluconeogenesis
nfu00051  Fructose and mannose metabolism
nfu00052  Galactose metabolism
nfu00500  Starch and sucrose metabolism
nfu00520  Amino sugar and nucleotide sugar metabolism
nfu00524  Neomycin, kanamycin and gentamicin biosynthesis
nfu01100  Metabolic pathways
nfu01200  Carbon metabolism
nfu04910  Insulin signaling pathway
Module
nfu_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
nfu_M00549  Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:nfu00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    107381906
   00051 Fructose and mannose metabolism
    107381906
   00052 Galactose metabolism
    107381906
   00500 Starch and sucrose metabolism
    107381906
   00520 Amino sugar and nucleotide sugar metabolism
    107381906
  09110 Biosynthesis of other secondary metabolites
   00524 Neomycin, kanamycin and gentamicin biosynthesis
    107381906
 09150 Organismal Systems
  09152 Endocrine system
   04910 Insulin signaling pathway
    107381906
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:nfu04131]
    107381906
Enzymes [BR:nfu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.1  hexokinase
     107381906
Membrane trafficking [BR:nfu04131]
 Autophagy
  Mitophagy
   Other mitophagy associated  proteins
    107381906
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Hexokinase_2 Hexokinase_1
Motif
Other DBs
NCBI-GeneID: 107381906
NCBI-ProteinID: XP_015809329
LinkDB All DBs
Position
sgr07
AA seq 1863 aa AA seqDB search
MFVAHLVSFYFSKLQEDPTKKVDRFLHAMRLNDDQLNELSARFQAELKKGLSAESNAAAA
VKMLPTHVCSTPDGSEKGQFLALDLGGSKFKVLQVKVRECVGIKKGDVEMEEKIYPVPDE
LLTGRATELFDHVSESLKDFMHEKNISLEKKHPLAFTFSFPCDQSRLDQGTLLNWSKNYK
ARGLQGKDVVQALREAVERTEGLDVEILAMVNDTVATMMTCGFDDSYCEVGIIVGTGTNA
CYMEELRHIDLVEGDEGRMCVNTEWGSFGDDGALKDFLTEFDREVDAASSNPGKQIFEKM
VSGMHLGELVRLVVLKMAKLGKLFDGRVSDALRTKGKITTADVAAMDEYRNGLKNTKDVL
DELDLNPSDDDCIAVQHVSTIVSFRSSNLVAAGLAAILTRIRQNRNMGALRITVGVDGTV
YKTHPQYPKRLHKVVRRLLPECQVRFVLSESGSSKGAALVAAVAQRLTSLRRQVSETLSL
FRLKEEQLQLVKARMRSGLDAGLRSKSSSTIKMLPSFVYLTPDGTERGKYLALDLGGTNF
RALLVRFKKQTSRLYHKIYTIPLEIMQGTGEELFDHLAQCVCDFLDYMGLKNTRLPAGFT
FSFPCEQSAIDTGTLVAWTKGFKATDSEGHDVVSMLREAIKRRNDIDLDIVALINDTVGT
MMSCAHEDQRCEIGMIAGTGTNLCYMEELKNIEKIEQRATKTEEKTQKGEKNENAGAEKN
KKDGEMQKMCINTEWGGLGDDGCLDDIITLYDTEVDQNSINQGKQRFEKMTSGMYLGEVV
RQVLLDLTRRGLLFKGHVSETLKTPGIFETKYLSQIESDRLALLQVRSILQQLGLHGTCH
DSIIVKHVCLVVSRRAAQLCGAGMAAVVDKIRENRGLDHLDIAVGVDGSLYKLHPHFSQV
LKETVRVMAPQCDVTFQPSEEGSGKGAALIAAVARRKRDVGTRTRMIAAQLLAYYFTELK
DDQVKRIDKYLYSMRFSDETLLEIMQRFRRELVQGLGGDTNATAALKMLPTFVRSIPDGT
EKGDFIALDLGGSNFRILRVKVSHEKKQTVQMESEVYDTPEDIIHGSGTRLFDHVAECLG
DFMEKHNIKDKKLPVGFTFSFPCQQAKLNEGYLLTWTKRFKASGVEGMDVVQLLNKAIKK
RGDYEADIMAVVNDTVGTMMTCGFDDQRCEVGIIIGTGTNACYMEELRHIDLVEGDEGRM
CVNTEWGAFGDDGRLEDIRTEFDREIDRGSLNPGKQLFEKMISGMYMGELVRLILVKMAR
EGLLFEGRITPELLTKGKFETKHISAIEKSKEGLTKAKEILARLGVEPSADDCIAVQHVC
AIVSHRSANLVAAALAGILMRLKDNKGVARLRTTVGIDGSLYKMHPQYARRLHKTVRRLV
PDCDVRFLLSESGSGKGAAMVTAVAYRLAEQSHQIIQILSEFRLTTEQLLEVKKRMRTEI
ENGLAKSTQDSATVKMLPTFVRSTPDGTENGDFLALDLGGTNFRVLLVKIRSGKRRTVEM
HNKIYAIPLEVMQGTGEELFDHIVHCISDFLDYMGMKNARLPLGFTFSFPCRQTSLDAGI
LVTWTKGFKATDCEGEDVVGLLRDAIKRREEFDLDVVAIVNDTVGTMMTCAYEEPTCEVG
LIAGTGSNACYMEEMRNIEMVDGDDGQMCVNMEWGAFGDNGCLDDFRTEYDRAVDDLSLN
PGKQRYEKMCSGMYLGEIVRNILIDMTKKGFLFRGQISETLKTRGIFETKFLSQIESDRL
ALLQVRAILQHLGLDSTCDDSIIVKEVCGTVARRAAQLCGAGMAAVVDKIRENRGLDHLD
ITVGVDGTLYKLHPHFSGIMHETVKELAPRCNVNFLLSEDGSGKGAALITAVGCRFRQEL
NSK
NT seq 5592 nt NT seq  +upstreamnt  +downstreamnt
atgtttgttgctcatcttgtttctttctacttctccaaacttcaggaggatcccacaaag
aaggtggaccggtttcttcatgccatgcgtctcaacgatgaccagctgaatgagctctcg
gcacgttttcaggctgaattgaagaaggggctttctgcagaaagcaatgcagcagcagct
gtaaaaatgctgccaactcacgtttgttccactccggatggatcagagaaaggtcagttc
ctggctctggatctcggaggctccaagtttaaggtgctccaggttaaagtaagagaatgt
gtgggcattaaaaagggagatgtggagatggaggagaagatctatccagtaccagatgag
ctgctcactgggagagcaacagagttatttgaccacgtgtcagagtctctgaaggatttc
atgcatgaaaagaacatcagtctggaaaaaaaacaccccttagcattcaccttctctttc
ccgtgcgatcagtcccgtttggatcagggaacgttgttgaactggagcaagaactacaag
gctcgaggccttcaggggaaagatgtggtccaggctctcagagaagctgttgaaagaaca
gagggtttagatgtagaaatattagcaatggttaatgacaccgtagccaccatgatgacc
tgtgggtttgatgactcgtactgtgaagtgggaattatcgttggcaccggcaccaacgcc
tgctacatggaggaacttcgtcacatcgacctggtggagggagatgaggggcggatgtgt
gtgaacactgagtggggttcatttggagatgatggagccctgaaggatttcctaactgag
tttgacagggaggtggacgcagcttccagcaacccaggaaaacaaatatttgagaagatg
gtcagtgggatgcacctgggggagctggtgaggctggttgtgttaaagatggccaaacta
ggaaagctgtttgatggacgtgtgtcagatgctctgaggaccaaagggaagataaccact
gcagatgttgcagcaatggatgagtacagaaacggtcttaaaaacaccaaagatgttcta
gatgagcttgatttgaacccatcagatgacgactgcatcgctgttcaacatgtcagcacc
atcgtgtccttcaggtcctctaatctggtggctgcaggactggctgccatcttgactcga
atcaggcaaaaccgtaatatgggagcgctgagaatcaccgtaggtgtggatggtaccgtg
tacaaaacacacccgcagtatcccaaacgccttcacaaagtggtgaggcggttgcttccc
gagtgccaggttcgatttgtcctctcagaaagcggcagcagcaaaggtgctgccttagta
gcagcagttgcacaacgtctgacatcactgagacgacaggtttctgagacgctgtctctc
ttcagattaaaggaagagcaactccagctggtcaaagccaggatgagatcagggctggac
gcaggactgaggagtaaaagctcctccaccataaaaatgctgccttcctttgtttacctc
acgccggacggtacagagcgtgggaaatacctcgccttggatctgggaggaacaaacttc
agagctttgcttgtgagatttaaaaagcagacgtccagactttatcataaaatttacacc
attccactagagatcatgcagggaactggggaggagctgtttgaccacctagcgcagtgt
gtgtgtgatttcctggactacatgggattaaagaacacccgtcttcctgcaggtttcacc
ttctccttcccctgtgagcagtcagccatcgatacaggaacgttggtggcctggactaaa
ggtttcaaggcaactgacagtgagggacacgatgttgtcagcatgctacgagaggccatc
aagaggcgcaacgatattgacttggacatagtagcattaatcaacgacacagtcgggacc
atgatgagctgcgcccatgaagaccaacggtgtgaaattgggatgatcgctggaactggc
accaatctttgctacatggaggaactgaagaacattgagaaaatcgaacaaagagccaca
aaaacagaggaaaagacgcagaaaggggagaagaatgagaatgctggtgcagaaaaaaat
aaaaaagatggcgagatgcaaaagatgtgtataaacacagagtgggggggtctgggtgat
gacggctgtctggacgacatcataacgctttatgacaccgaggtggaccaaaactccata
aaccaaggaaagcaacggtttgaaaagatgaccagcgggatgtatttgggggaagtggtt
cgacaggtgttactggatctaaccagaagaggcctgctgtttaaaggacacgtctctgaa
accttaaaaacacctggaatatttgagactaaatacctgtcacagatagagagtgatcgc
ttggctctgctgcaggtcaggtccattctgcagcagctgggcctccacggcacctgtcac
gacagcatcatagtcaagcatgtttgtttagtggtgtcacgtcgagccgctcagctgtgt
ggagcaggaatggccgcggtggtagataagatcagagagaaccgagggctggaccacctg
gacatcgctgtgggggtcgacgggtctctctataaacttcatccacatttctcccaggtc
ctgaaagagacggtgagagtcatggctcctcagtgtgacgtgaccttccagccttcagag
gagggcagtgggaaaggagctgcccttatcgcagctgttgcccgacgcaagcgagacgtc
ggaacaaggaccagaatgattgcagcccagttattagcctattacttcacagagctcaag
gatgaccaggtcaaaaggatcgataagtacctgtactctatgcggttctccgatgagacg
ttgctggagatcatgcagcggttcaggcgggagctagtccaaggactgggcggggacacc
aacgccaccgctgccctgaagatgctgccaacgtttgtgcgctcgatccccgatggaaca
gagaaaggagacttcatcgccttggatttggggggcagtaacttcagaatccttcgcgtc
aaagtgagccacgagaagaagcagacagttcagatggagagtgaggtttacgacacgcct
gaggacatcatccacggcagtgggacaagactgttcgatcacgtggcagagtgtctcgga
gacttcatggaaaaacacaacatcaaagacaagaaactccctgtggggttcaccttctcc
ttcccctgccagcaggccaagctaaacgagggctacctgctaacgtggacaaagcgtttc
aaagccagcggggtagaagggatggatgttgtccagctgctcaataaagctattaaaaaa
cgaggggactacgaagctgacatcatggcagtggtgaatgacaccgtgggaactatgatg
acatgcggcttcgacgaccagcgttgtgaagttggcatcatcattggcaccggcaccaac
gcctgctacatggaggagcttcgccacatcgacctggtggagggagacgagggacggatg
tgcgtcaacaccgagtggggggctttcggagacgacgggaggctggaggacatcaggacg
gagtttgacagagagattgaccgaggctcactcaacccaggcaaacagctatttgagaag
atgatcagtgggatgtacatgggggagctggtccgtctcatcctggtgaagatggccaga
gaaggtctcctctttgaaggaaggatcacccctgagctcctcaccaagggcaaatttgag
actaaacacatctcagccatagagaagagtaaggaaggtttgaccaaagcaaaggagatt
ttagcccgactcggtgtggagccctcagcggacgattgcatcgctgtgcagcacgtttgc
gccatcgtctctcaccgctctgccaacctggtggccgctgccctggccggcatcctgatg
aggctgaaggacaacaaaggcgtggctcgactccggaccaccgtgggcatcgacggctcc
ctttacaagatgcacccacagtacgcccgtcgtcttcataagaccgtccgacgtctggtc
cccgactgcgacgtccgattcctcctctcagagagtggcagcgggaagggcgctgccatg
gtaacagctgtggcctatagactcgcagaacaatcccatcaaatcatccaaatcctgtct
gaattccgcctgacgacagaacagctgctggaggtaaagaagagaatgaggacagagatt
gaaaatggcctcgctaaaagcacccaggactcagccacggtcaaaatgctgccgactttt
gtacgaagtacacctgatggcacagagaacggtgatttcctggctttggacttgggagga
accaacttccgggtgttgttggtgaagatccgctctgggaagaggagaacggtggagatg
cacaacaagatttacgctattcctctagaagtgatgcagggcacgggagaggagctgttt
gatcacatcgtgcactgcatcagtgacttcctggactacatggggatgaagaacgctcgt
cttcctctaggcttcaccttctcgtttccatgccgacagacaagtctggatgctggtatc
ttggtgacgtggaccaaaggctttaaggcgacggactgtgaaggagaggatgtggtggga
ctgctgagggatgctattaagcgaagagaggagtttgatctggatgtggtggctatagtc
aatgacacggtgggaaccatgatgacctgtgcctacgaagagcccacctgtgaggttgga
cttattgctggaacgggcagcaacgcttgttacatggaggagatgaggaacattgagatg
gtcgatggcgatgacggacagatgtgtgtcaacatggagtggggtgcttttggagacaac
gggtgcctcgatgacttcaggacagaatacgaccgcgctgtggacgacctctctctcaat
ccaggaaaacaaaggtatgagaagatgtgcagcggcatgtacctcggtgagattgtgagg
aacatcctcatagacatgaccaagaaaggattcttgttccgagggcagatttctgaaacc
ctgaagaccagaggcatctttgaaacaaagtttctctcacagattgagagtgacagactg
gctttgctgcaggtgagagccatcctgcaacacctgggtctggacagcacctgtgatgac
agtatcattgtgaaagaggtttgtggaacggtggcgcgtcgtgctgctcagctgtgtggg
gcggggatggcggcggtcgtggataagataagggagaaccgcggactggaccatctggac
atcaccgtgggggtcgacgggactctgtacaaattacatccacatttctctggcatcatg
cacgagactgttaaagaactggctcctcggtgtaacgtcaacttcctgctgtcagaggac
ggcagcgggaaaggagctgctctcattaccgctgtgggctgccgattcagacaggagcta
aacagtaaataa

DBGET integrated database retrieval system