KEGG   Nothobranchius furzeri (turquoise killifish): 107382658Help
Entry
107382658         CDS       T05163                                 

Definition
(RefSeq) ATP-dependent 6-phosphofructokinase, platelet type-like isoform X1
  KO
K00850  6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
nfu  Nothobranchius furzeri (turquoise killifish)
Pathway
nfu00010  Glycolysis / Gluconeogenesis
nfu00030  Pentose phosphate pathway
nfu00051  Fructose and mannose metabolism
nfu00052  Galactose metabolism
nfu01100  Metabolic pathways
nfu01200  Carbon metabolism
nfu01230  Biosynthesis of amino acids
nfu03018  RNA degradation
Module
nfu_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:nfu00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    107382658
   00030 Pentose phosphate pathway
    107382658
   00051 Fructose and mannose metabolism
    107382658
   00052 Galactose metabolism
    107382658
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03018 RNA degradation
    107382658
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:nfu01009]
    107382658
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:nfu03019]
    107382658
Enzymes [BR:nfu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     107382658
Protein phosphatases and associated proteins [BR:nfu01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     107382658
Messenger RNA biogenesis [BR:nfu03019]
 Prokaryotic Type
  Bacterial mRNA degradation factors
   RNA degradosome components
    Other RNA degradosome components
     107382658
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PFK Hum_adeno_E3A
Motif
Other DBs
NCBI-GeneID: 107382658
NCBI-ProteinID: XP_015810374
UniProt: A0A1A8AZE8
LinkDB All DBs
Position
sgr08
AA seq 790 aa AA seqDB search
MAQPDTKKIFFENLSGAGKAIAVLTSGGDAQGMNAAVRAVVRMGIYVGAKVYLIHEGYQG
MVDGGENIKEATWEGVSSMLQVGGTVIGSARCKDFRSHEGRLKAAHNLVRHGITNLCVIG
GDGSLTGANLFREEWSGLLAELVEQGLIEADAVQKYSALHIVGMVGSIDNDFCGTDMTIG
TDSALHRIIEVVDAIMTTAQSHQRTFVLEVMGRHCGYLALVSALACGADWVLIPEMPPED
GWEEKMCQKLSATRSRGTRLNIIIVAEGAIDRHGKPITSSFVKDLVVKNLGFDTRVTILG
HVQRGGTPSAFDRILASRMGVEAVLALLETTANTPACVVSLCGNQSVRVPLMECVQTTQE
VQKAMDQKRFEEAVKLRGRSFENNLKTYKLLAHRKPESELPTSNFNVAVLNVGAPAAGMN
AAVRSAVRVGISEGHKMFAVNDGFEGFYKGQIKEIKWGDVGGWTGQGGSLLGTKRTLPAK
HVEKIAEQMRKHNINALLVIGGFEALLSLLELSAARGKYDEFCVPMVMVPATVSNNVPGS
DLSIGADTALNAITTTCDRIKQSASGTKRRVFIIETMGGYCGYLATVGGLAAGADAAYIY
EEPFDIRDLQANVEHLTEKMKTSIQRGLVLRNENSSDNYTTDFIYQLYSEEGKGVFDCRK
NVLGHMQQGGAPSPFDRNFGTKISAKAMQWLSQKLVETYRRDEGQVFANTEDSCCLLGMR
ARALVFQPVVQLKDDTDFVHRIPKEQWWLKLRPLMKILAKYKTSYDVSDSGQVEHVIHSR
PKDSDASVAM
NT seq 2373 nt NT seq  +upstreamnt  +downstreamnt
atggcgcagccagacaccaagaaaatattctttgagaacctgtcgggagcagggaaagcc
atcgccgtgctgacaagcggaggagatgctcaagggatgaatgctgctgtgcgtgctgtg
gtccggatggggatctacgtgggtgcaaaagtttatctcattcatgagggatatcagggt
atggtggatggaggggagaacataaaggaggccacatgggagggtgtctccagtatgctg
caagtgggcgggactgtgatcggcagcgctcgctgcaaagacttccgctcccacgaggga
cggctgaaggccgctcacaacctggtgcgtcacggcatcaccaacctgtgtgtgatcgga
ggagacggcagcctgacgggggccaacctcttcagggaggagtggagcgggctactggct
gagctggtggagcaaggactgatcgaagctgacgcggtccagaagtactctgcccttcac
atcgtggggatggtgggctccatcgataacgacttctgtggaaccgacatgaccatcggc
actgactctgctttgcacaggatcatcgaggtggtggatgcgattatgacgaccgcccag
agccaccagaggacgtttgtgttggaggtcatgggcagacactgcggctacctggccctg
gtgagcgcgctggcctgcggtgcagactgggtgttgatccctgagatgccgcctgaggat
ggctgggaggagaagatgtgtcagaaactatcagcgacccggtccaggggcacaaggctc
aacattatcatagtcgcagagggagccattgacaggcacgggaaacctatcacttctagt
tttgtcaaggatctcgttgtcaaaaacctgggcttcgacacacgagtgacgattctgggc
catgtgcagagaggaggaacaccttctgcctttgaccgcatcttggccagtcgtatgggg
gtggaggctgttctggccctgttggagaccaccgccaacacaccggcctgtgtggtttct
ctgtgtgggaaccagtcggtgcgtgtgcctctgatggagtgtgtacagacgactcaagaa
gtccagaaggccatggaccagaagcggtttgaggaggccgtgaagcttcggggcaggagc
tttgaaaacaacctgaagacgtacaaactgctggctcatcgtaaacctgagtctgaactg
cccactagcaactttaacgtggcggtgctgaacgttggagcccccgctgccggcatgaac
gccgctgtccgttcggcggtcagggtggggatctctgagggacacaagatgtttgcagtc
aacgatggttttgaaggcttctacaaaggacagattaaggagattaaatggggagatgtc
ggaggatggacaggacagggtggctcgcttttaggaaccaaaagaacacttcctgcaaag
catgtggagaaaatagccgagcagatgcggaagcataacatcaacgctctgctggttatc
ggtggattcgaggccttgctgtcgctgctggaattgtcagcggctcgtgggaaatatgac
gagttctgtgtgccgatggtcatggtcccagccactgtctccaacaatgtgcctggctca
gacctcagcattggcgccgacacggctctgaacgccatcactactacttgtgaccgcatc
aagcagtcggccagcgggaccaagaggcgtgtgttcatcattgagaccatggggggctac
tgtggctacctggctactgtcggaggcctggcggctggtgctgatgcagcttacatctac
gaggagccctttgacatcagagatctgcaggcgaacgttgagcatctgacagagaaaatg
aagaccagcatccagagaggactggttctcaggaatgagaacagcagcgacaactacaca
acggacttcatttatcagctgtactcagaagaagggaagggggtgtttgactgcaggaag
aacgtgctgggacacatgcagcagggaggtgcgccgtcgccgtttgatcgtaactttggg
accaagatctcagccaaggcgatgcagtggctctcccagaagctggtggagacgtacaga
cgagacgaaggacaagtgtttgccaacaccgaggactcctgctgtctgctggggatgcgt
gccagggctctggtcttccaacctgttgtgcagctcaaagatgacactgactttgttcac
aggatccctaaagaacaatggtggctgaagctgcgtcctctgatgaagatcttggccaag
tacaagacgagctatgatgtctcggactcgggacaggtggaacacgtcatccacagtcga
cccaaagactctgacgcttcagtagccatgtga

DBGET integrated database retrieval system