KEGG   Nothobranchius furzeri (turquoise killifish): 107383138Help
Entry
107383138         CDS       T05163                                 

Gene name
ezh2
Definition
(RefSeq) histone-lysine N-methyltransferase EZH2
  KO
K11430  histone-lysine N-methyltransferase EZH2 [EC:2.1.1.43]
Organism
nfu  Nothobranchius furzeri (turquoise killifish)
Pathway
nfu00310  Lysine degradation
Brite
KEGG Orthology (KO) [BR:nfu00001]
 Metabolism
  Amino acid metabolism
   00310 Lysine degradation
    107383138 (ezh2)
Enzymes [BR:nfu01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.43  histone-lysine N-methyltransferase
     107383138 (ezh2)
Chromosome and associated proteins [BR:nfu03036]
 Eukaryotic Type
  Histone modification proteins
   HMTs (histone methyltransferases)
    HKMTs (histone lysine methyltransferases)
     107383138 (ezh2)
   Polycomb group proteins
    PRC2-EZH2 complex
     107383138 (ezh2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: SET EZH2_WD-Binding
Motif
Other DBs
NCBI-GeneID: 107383138
NCBI-ProteinID: XP_015811085
UniProt: A0A1A8AT51
LinkDB All DBs
Position
sgr08
AA seq 758 aa AA seqDB search
MVLTGKRSEKGPACWKRRVKSEYMRLRQLKRFRRADEVKSMFNSNRQKIMERTDILNQEW
KTRRIQPVHIMTSVSSLRGSRECTVDTGFSEFSRQVIPLKTLNAVASVPVMYSWSPLQQN
FMVEDETVLHNIPYMGDEILDQDGTFIEELIKNYDGKVHGDRECGFINDEIFVELVSALS
QYSDNEDDDEDEEEQDFKVDKMDLCDGKEQPEDHRKDRLEGRTNDINKKFPSDKIFEAIS
SMFPDKGSTEELKEKYKELTEQQLPGALPPECTPNIDGPNARSVQREQSLHSFHTLFCRR
CFKYDCFLHPFHATPNTYKRKNLENLVDSKPCGMHCYMYLVQDGMEYPAGMVAERAKTPS
KRTVGRRRGRQPNSNSNSRPSTPTVSSETKDTDSDHEGSKEDERENDKDDEDKKDETTSS
SEGNSRCETPVKMKLSSEAEAVEWSGAEASLFRVLIGTYYDNYCAIARLIGTKSCRQVYE
FRVKESAIIARAPAEDEDTPPRKKKRKHRLWATHCRKIQLKKDGSSNHVYNYQPCDHPRQ
PCDSSCPCVTAQNFCEKFCQCSSECQNRFPGCRCKAQCNTKQCPCYLAVRECDPDLCLTC
GAADHWDSKNVSCKNCSIQRGAKKHLLLAPSDVAGWGIFIKEPVQKNEFISEYCGEIISQ
DEADRRGKVYDKYMCSFLFNLNNDFVVDATRKGNKIRFANHSVNPNCYAKVMMVNGDHRI
GIFAKRAIQTGEELFFDYRYSQADALKYVGIEREMEIA
NT seq 2277 nt NT seq  +upstreamnt  +downstreamnt
atggtgctgacggggaagcgctcagagaaaggtccggcctgctggaagaggcgggtcaag
tctgagtacatgaggctccggcagctgaaacgcttcagacgtgctgatgaggtcaagagc
atgttcaactccaaccgtcagaaaatcatggagcgaacagatattttgaaccaggagtgg
aaaacccggcggatccagcccgttcacatcatgacgtctgtcagctctctgcggggaagc
cgagagtgcaccgtggacaccggcttctcagagttttcccgtcaggtcattcctctgaag
acgctgaatgcggtggcctcagttcctgtcatgtactcctggtctccgctgcagcagaac
ttcatggtggaggatgagacagtccttcataacattccctacatgggagacgagattctg
gaccaggatggaacttttatagaggaactcataaagaactacgatggaaaagttcatgga
gacagagagtgcggcttcatcaacgatgagatcttcgtggagttggtcagcgcgctgtcc
cagtacagcgacaacgaggacgatgatgaagacgaggaagaacaagattttaaggtggac
aaaatggacttgtgtgatggtaaagagcagccagaggatcaccgtaaggaccgactggag
ggccgaaccaatgacatcaacaagaagtttccatctgataagatttttgaagccatctcc
tccatgtttcctgacaaaggctccaccgaggagctgaaagagaagtataaggagctgacg
gagcagcagctccccggcgcgctgcctcccgagtgcacgccgaacatcgatgggccgaac
gcgcgctccgtgcagcgcgagcagagcctgcactccttccacacgctgttctgcagacgc
tgcttcaaatacgactgtttcctccaccctttccatgcaactccaaacacgtacaagcgc
aagaacctggagaacctggtggactcgaagccctgtggcatgcactgctacatgtacctg
gtgcaggatgggatggagtacccagcaggtatggtggccgagcgagccaagacgccctcc
aaacgcacggtgggccgtcgccgtggacgacagcccaacagcaacagtaacagccgcccc
agcacccccaccgtctcctcggaaaccaaagacaccgacagcgaccacgagggaagcaaa
gaggacgagcgcgagaacgacaaagacgacgaggacaagaaggacgaaacgaccagcagc
tccgagggaaactctcgctgcgagacgccggtgaagatgaagctgagcagcgaggctgaa
gccgtggagtggagcggagctgaagcttctctcttcagagtcctcatcgggacgtactac
gacaactactgcgccatcgctcgactaatcggaaccaagtcctgcagacaggtttacgag
ttcagggtgaaagagtcggccatcatcgcccgagctcctgctgaagacgaggacacgccc
cccaggaagaagaagaggaagcaccggctgtgggccacacactgcaggaagatccagctg
aagaaagatggatcgtccaatcacgtgtacaactaccagccatgtgaccacccccgccag
ccgtgtgactcttcgtgtccctgcgtcaccgctcagaacttctgtgagaagttctgtcag
tgcagctctgagtgtcagaaccgtttcccgggctgccggtgcaaagcccagtgcaacacc
aagcagtgcccctgctacctggcagtgagggagtgtgacccggatctgtgcctgacctgc
ggcgccgcagaccactgggacagcaagaacgtgtcctgcaagaactgctccatccagaga
ggagccaagaagcacctgctgctggcgccgtccgacgtggcgggctggggcatcttcatc
aaagagccagttcagaagaacgagttcatctccgagtactgtggagagatcatctctcag
gatgaagctgaccgcagagggaaggtctacgataaatacatgtgcagcttcctgttcaac
ctgaacaacgactttgtggtggacgccaccaggaaaggaaacaagatccgctttgctaac
cattctgtcaaccccaactgctatgcaaaagtgatgatggtcaacggcgaccacaggatc
ggcatcttcgccaagagagccattcagaccggggaggagctgttcttcgactacaggtac
agccaggctgatgctctgaagtacgtgggcatcgagcgtgagatggagatcgcctga

DBGET integrated database retrieval system