KEGG   Nothobranchius furzeri (turquoise killifish): 107383457Help
Entry
107383457         CDS       T05163                                 

Gene name
lig1
Definition
(RefSeq) DNA ligase 1
  KO
K10747  DNA ligase 1 [EC:6.5.1.1 6.5.1.6 6.5.1.7]
Organism
nfu  Nothobranchius furzeri (turquoise killifish)
Pathway
nfu03030  DNA replication
nfu03410  Base excision repair
nfu03420  Nucleotide excision repair
nfu03430  Mismatch repair
Brite
KEGG Orthology (KO) [BR:nfu00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03030 DNA replication
    107383457 (lig1)
   03410 Base excision repair
    107383457 (lig1)
   03420 Nucleotide excision repair
    107383457 (lig1)
   03430 Mismatch repair
    107383457 (lig1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:nfu03032]
    107383457 (lig1)
   03400 DNA repair and recombination proteins [BR:nfu03400]
    107383457 (lig1)
Enzymes [BR:nfu01000]
 6. Ligases
  6.5  Forming phosphoric-ester bonds
   6.5.1  Ligases that form phosphoric-ester bonds (only sub-subclass identified to date)
    6.5.1.1  DNA ligase (ATP)
     107383457 (lig1)
    6.5.1.6  DNA ligase (ATP or NAD+)
     107383457 (lig1)
    6.5.1.7  DNA ligase (ATP, ADP or GTP)
     107383457 (lig1)
DNA replication proteins [BR:nfu03032]
 Eukaryotic Type
  DNA Replication Elongation Factors
   Other elongation factors
    107383457 (lig1)
 Prokaryotic Type
   Elongation factors (archaeal)
    Other elongation factors
     107383457 (lig1)
DNA repair and recombination proteins [BR:nfu03400]
 Eukaryotic Type
  SSBR (single strand breaks repair)
   BER (base exicision repair)
    Long Patch-BER factors
     107383457 (lig1)
   NER (nucleotide excision repair)
    Other NER factors
     107383457 (lig1)
   MMR (mismatch exicision repair)
    Other MMR factors
     107383457 (lig1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DNA_ligase_A_M DNA_ligase_A_N DNA_ligase_A_C
Motif
Other DBs
NCBI-GeneID: 107383457
NCBI-ProteinID: XP_015811562
UniProt: A0A1A7ZQQ2
LinkDB All DBs
Position
sgr09
AA seq 1002 aa AA seqDB search
MQRSIASFFQPKSKDKDNLTKHADEAAKKPVKSPLKVQNGVQEADSPIKKVAKRSRQILD
SDEDEATVVKEQAATKEHEDKEAKSEKSDHVLKEVSTPLSPPAATQSPVTPATPASSTSS
GSPSTPSSISPSGIIKRKTARKMFPKRKLDESGSGGESRKEESKVTEEQGQQNKRPRVES
CVSSAGNTDEPMEEGAEEERVEKAATEANSPDEEVENKKKEEAEKAKKEEEQVKKRSSDE
REKKAEEAEKKTGAKEKTDDEKGPTVAKEEVVEKDTQDTGSPKSQKQKEVKEQKDKEPAK
KAPISSFFAPRKAAAKTEKTETNEGEKKMERKSSEEERKDRKSESTSEQTDYDPSRPNYH
PVEHACWKQGQKVPYLAVARTFEKIEQDSGRLRNIETLSNLLRSVLLLSPDDLLCCVYLC
LNQLGPAYLGMELGVGEMVLMKAVAQATGRQLDKIKSEAQEKGDLGLVAESSRSNQRMMF
QPASLTAGGVFRKLKEIASMSGNSAMNKKIDIIKGLFVACRFSEARYIVRSLAGKLRIGL
AEQSVLSALSQAVCLTPPGQGFPPAVIDAGKGMSAESRRAWIEEKSLILKQIYCEMPNYD
VIIPVLLKEGIDQLPNHCKLTPGIPLRPMLAHPTKGVGEVMKRFDEAAFTCEYKYDGERA
QIHILEGGEVRIFSRNQEDNTSKYPDIVSRIPKVKKDSVVSCVLDSEAVAWDREKKQIQP
FQVLTTRKRKDVDASEIKVQVCVYAFDLLYLNGESLVRQPLCRRRALLRESFSEMEGEFQ
FARFIDSDNTDIIAEFLEQSVRDSCEGLMVKTLEKDATYEIAKRSHNWLKLKKDYLDGVG
DTVDLCVIGAYLGKGKRTGTYGGFLLACYDEENEEFQSVCKIGTGFKDEDLEQHHKFLKE
HILPKPRPYYRVDQSAEPDVWLDAVQVWEVKCADLSLSPVYKAAMGTVDPEKGISLRFPR
FLRIRDDKKPEDATSGAQIADLYKKQQQILNQRDKADPEDYY
NT seq 3009 nt NT seq  +upstreamnt  +downstreamnt
atgcagcggagcattgcatcatttttccagcccaagagcaaagacaaggacaatctgacg
aaacatgcagatgaagcagcaaagaagcccgtcaagagtcccctcaaggtgcagaacggt
gtccaggaagctgattcgcccatcaagaaggttgccaaacgcagccgtcaaatcctggac
agcgatgaggacgaggccacagtcgttaaagaacaagctgccaccaaagaacacgaagac
aaagaagcgaaatcagagaagagtgaccatgtgttgaaggaggtttccacccccctgtct
ccaccagctgcaactcagtcccccgttaccccggcaaccccagcctcttcaacatcctct
gggtctcccagcacccccagttccatctctccatctggaatcatcaaacgcaaaactgcg
aggaagatgttccccaagaggaagctggatgagagcgggagcggcggagagagtcggaaa
gaggagtccaaggtcaccgaggagcagggtcagcaaaacaaacgaccccgtgtggagagc
tgtgtcagcagcgcagggaacaccgatgaacccatggaggagggagcagaggaagaaagg
gttgaaaaggcagcgactgaggctaacagcccagatgaggaggtggagaacaaaaagaaa
gaagaagcagagaaggccaagaaggaggaggagcaggtgaagaaaaggagctctgatgag
agagaaaagaaagctgaggaggcggaaaagaaaactggagcgaaggagaagactgatgat
gagaaagggcccactgtcgccaaagaggaggtggttgaaaaggacacgcaagacacgggg
agcccgaaaagtcaaaagcagaaggaggtgaaggagcagaaagataaggagcctgccaaa
aaagccccaatcagcagtttctttgctcccaggaaagctgcagcgaagacagaaaaaact
gagacgaatgaaggagagaagaagatggagaggaagagctcagaggaggagcgcaaagac
agaaaaagtgagtccacctcagaacaaacggactatgatccatccaggccaaactaccat
ccggtagaacacgcctgctggaaacaaggccagaaagtgccgtacttggcagtggctcgc
acctttgagaaaattgaacaggactctggcaggctgagaaacatcgagacgctgtcaaac
ctgcttcgctctgttctgctgctctctccagatgacctcctgtgctgtgtgtacctgtgc
ttgaaccagctgggccccgcctacctcgggatggagcttggtgtaggagaaatggtgctg
atgaaagccgttgctcaagcaactgggcgacagttggacaaaattaaatccgaggcgcag
gagaaaggagatttgggccttgtggccgagagttcccgtagcaaccaacgcatgatgttc
caaccggccagcctgactgcagggggtgtgttcaggaaattgaaggaaattgccagcatg
agtgggaactcggccatgaataagaaaatcgacatcatcaaaggcctctttgtggcatgc
cgcttttcagaggcccgctacatagtcaggtctcttgctgggaagctgaggattggcctt
gctgagcagagcgtgctttctgccctgagccaagctgtctgtctgactccgcctggacaa
ggtttccctcctgctgtgattgacgcagggaaaggcatgagcgctgaaagcaggcgggcc
tggatcgaagagaagagcctcattctaaagcaaatatactgcgagatgcccaattacgac
gtcatcattcctgttttgctaaaagaaggcatcgaccagctgcccaatcactgcaagctt
actccaggcataccgctgagacccatgttggctcatcccaccaagggtgtcggggaggtg
atgaagaggtttgacgaggcagcgttcacctgcgagtataaatacgatggggaacgtgca
cagattcacattcttgagggtggtgaagttcggatattcagccgcaaccaggaagacaac
accagcaaataccccgatatcgtctctcgcattcccaaggtaaagaaggactctgtggta
tcttgtgtcctggactctgaggcggtggcctgggaccgtgaaaagaaacagatccaaccc
ttccaagtcctcaccactcgtaagaggaaggatgtggatgcctcagagatcaaagtccaa
gtgtgcgtgtatgcctttgacctcctctatctcaatggagagtccctggtgcgtcaaccg
ctgtgtcggcgtcgggcgctgctgagagaaagcttctcagagatggaaggagagtttcag
ttcgcccgtttcatcgactctgacaacaccgatatcattgcagagttcctagagcagtct
gtccgagactcttgtgaaggcctgatggtgaagactttggagaaggatgctacctacgag
attgccaagcgttctcataattggctcaagctaaagaaagattacctggacggagtgggc
gacaccgtggacctgtgtgtgatcggcgcctatctggggaaaggaaaaaggaccggcact
tacggagggttcctgctggcctgctatgatgaagaaaatgaagagtttcagtcggtctgc
aagatcgggacaggctttaaggatgaagatctggagcagcatcacaagtttttaaaggag
cacatccttcccaagccacgcccctactaccgtgtggaccaatcggccgagcctgacgtg
tggctggatgccgtgcaggtttgggaggtgaagtgcgccgacctctcgctgtcgcctgtc
tacaaggctgccatgggaacggtggatccagagaaaggaatttctctcaggttcccgcgc
ttccttcggattagagatgacaagaagccagaggacgccacaagcggagctcagatcgct
gatttgtacaagaagcagcagcagattctgaaccagagagacaaagctgacccggaggac
tactactga

DBGET integrated database retrieval system