KEGG   Nothobranchius furzeri (turquoise killifish): 107384056
Entry
107384056         CDS       T05163                                 

Definition
(RefSeq) cyclin-dependent kinase inhibitor 1B-like
  KO
K06624  cyclin-dependent kinase inhibitor 1B
Organism
nfu  Nothobranchius furzeri (turquoise killifish)
Pathway
nfu04012  ErbB signaling pathway
nfu04068  FoxO signaling pathway
nfu04110  Cell cycle
Brite
KEGG Orthology (KO) [BR:nfu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    107384056
   04068 FoxO signaling pathway
    107384056
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    107384056
SSDB
Motif
Pfam: CDI
Other DBs
NCBI-GeneID: 107384056
NCBI-ProteinID: XP_015812573
UniProt: A0A1A8AHK3
LinkDB
Position
sgr01
AA seq 190 aa
MCNKMSDVRLSNASPTVERVDARQPENVRSVCRALFGTPDREETRRYAATLQQESRLDFM
ERYNYDPVADRPLSPGNYEWEEDGEAPEFYRRPPHGSQRPRAEADSPSENHRGSGEEDDG
RRTESAQGSNGSRKRRSDTAASCSEECSTKRSNSDRGEDDDDEGCEGSQSVSVSRPGDKE
AVPLKPVPEH
NT seq 573 nt   +upstreamnt  +downstreamnt
atgtgcaacaaaatgtcagatgttcgcctttccaacgcgagcccgaccgtggagcgggtg
gacgcgcggcagcccgagaacgttcgctcagtgtgcagggcgctgttcggtacacctgac
cgggaggagactcggaggtacgcggccaccctgcagcaggaaagcaggctggattttatg
gagagatataactacgatccagtggcggacagaccgctctctccgggaaattacgagtgg
gaggaggacggcgaagcaccggagttttaccgcaggccgcctcacgggagccagcggccc
cgggcggaggctgactcacccagtgaaaaccaccgaggcagcggcgaggaggacgacggg
aggaggacggaatctgcacaagggagtaacggttcacggaaacggagatcagacacagca
gcttcttgctccgaagaatgttcgacgaaaaggtcgaattccgatagaggggaggatgat
gatgacgagggctgcgaaggaagtcaatctgtatcggtcagcaggcctggggacaaagag
gcagtccccttaaagccggtgccagagcactga

DBGET integrated database retrieval system