KEGG   Nothobranchius furzeri (turquoise killifish): 107384696Help
Entry
107384696         CDS       T05163                                 

Gene name
gpd2
Definition
(RefSeq) glycerol-3-phosphate dehydrogenase, mitochondrial isoform X1
  KO
K00111  glycerol-3-phosphate dehydrogenase [EC:1.1.5.3]
Organism
nfu  Nothobranchius furzeri (turquoise killifish)
Pathway
nfu00564  Glycerophospholipid metabolism
Brite
KEGG Orthology (KO) [BR:nfu00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    107384696 (gpd2)
Enzymes [BR:nfu01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.5  With a quinone or similar compound as acceptor
    1.1.5.3  glycerol-3-phosphate dehydrogenase
     107384696 (gpd2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DAO DAO_C EF-hand_7 EF-hand_1 FAD_binding_2 EF-hand_6 FAD_oxidored Pyr_redox_2 EF-hand_8 GIDA Thi4 Pyr_redox_3 EF-hand_5 EF-hand_9 HI0933_like EF-hand_4 NAD_binding_8 SPARC_Ca_bdg
Motif
Other DBs
NCBI-GeneID: 107384696
NCBI-ProteinID: XP_015813557
LinkDB All DBs
Position
sgr10
AA seq 730 aa AA seqDB search
MAFRKALRRTAVVGGGAVAAAFGLSQLMEYRKTQPGLARLAHVAAEAELKVPYADELPSR
QAQLSALRDTAEFDVLVVGGGATGAGCALDAVTRNLKTALVERSDFSSGTSSRSTKLLHG
GVRYLQKAIMKLDYEQYMMVKEALHERANLLEIAPHLSAPLPIMLPVYKWWQLPYYWAGI
KMYDLVAGIQCLKSSYVLTKSKALEYFPMLKKDKLVGAIVYYDGQHNDARMNLAIALSAA
RYGAAIANYTEVVHLLKRKDQQSGKEKVCGVRCRDVITGQEFDVKAKCVINATGPFTDSL
RKMDEQEVANICQPSAGVHIVIPGYYSPDNMGLLDPATSDGRVIFFLPWENMTIAGTTDS
PTNVTAHPIPGEDDINFILTEVRNYLSSDVEVRRGDVLAAWSGIRPLVTDPNSKDTQSIC
RNHIVSISESGLVTIAGGKWTTYRSMAEETLDAAIGAHSLTAESCRTVGLMLEGAKGWTP
TLYIRLVQDYGLEKEVAQHLASTYGGRAFDVAKMAQVTGQRWPIVGKRLVSEFPYIEAEV
LYAIKEYACTAIDVIARRTRLGFLNVQAADEALPRIVQIMGKELNWSQEKRTEELEAAKK
FLYHEMGYRSRSEQLTKTSEINLDYQEVVRYKKRFHKFDKEKKGFITTVDVQRVLESINV
HIDENALHEILNEVDLNKNGQVEIDEFLQLMSAVKKGKVSDSRLAILMKTAEETLDERGP
VTVDRSGGGV
NT seq 2193 nt NT seq  +upstreamnt  +downstreamnt
atggcgttcaggaaggccctgagacggacggcggtcgtaggaggcggggcggtcgctgcg
gctttcggcctgtcacagctgatggaatacaggaagactcagcctggattggctcgatta
gctcatgtggctgcagaagccgagctgaaggtcccgtatgcagatgagctcccgtcccgg
caggcgcagctctcggcgctgcgagacaccgcggagtttgatgttctggttgttggagga
ggagccacgggagcaggatgtgccttagacgccgtcacacgcaacctcaaaacggcgctc
gtagaacgaagtgacttctcttcaggaaccagcagccggagcactaagctcctccacggt
ggggtccgatacctccagaaggccatcatgaaattagactacgaacagtacatgatggtg
aaagaagccctgcatgagcgggccaacctgctggagattgctccccacctgtcggcgccg
ctacccatcatgcttcctgtttacaagtggtggcagttgccttattactgggcaggaatc
aagatgtatgacttggtggctggaatccagtgcctgaagagcagctatgtcctcactaag
tccaaggccttggagtatttccccatgcttaagaaggacaagctggtaggagccatcgtc
tactacgatggacagcacaacgacgcccgtatgaacctggccatcgccctctctgctgct
cgatacggagccgccattgccaactacaccgaggtggtccaccttttaaagaggaaggac
cagcagagcggcaaggagaaggtgtgtggagttcgctgcagggacgtcatcacagggcag
gagttcgacgtgaaggcgaagtgtgtgattaacgctaccggccccttcacggattctctg
agaaagatggacgaacaggaagtagcgaacatctgccagcccagcgctggcgttcacatc
gtcatcccgggttactacagccctgacaacatggggctccttgatccagcgaccagtgat
ggacgagtcatcttcttcctgccctgggagaacatgaccatcgccgggacaaccgacagc
cccactaacgtgacggcccaccccatcccgggggaggacgacatcaacttcatcctgacg
gaggtccgcaactacctcagctccgatgtggaagttcgtagaggagacgttctggctgcg
tggagcggcatccgtcctctggtgaccgacccaaactctaaagacacccagtccatctgc
aggaaccacatcgtcagcatcagcgagagcgggctggttaccattgcaggtgggaagtgg
accacctacaggtccatggcggaggagactctggatgcagccatcggagctcacagcctg
acagctgaatcctgcaggactgtgggtctgatgctggagggggcaaagggctggacgccg
accctctacatccgcctggtgcaggactacggcctggagaaggaggtcgcccagcatctg
gcctcgacgtatggcggaagagcgtttgacgtggccaaaatggctcaggtgacgggtcag
aggtggccgatcgttgggaaacggctggtgtctgagttcccgtacatcgaggccgaggtt
ctgtacgccattaaggagtatgcctgcactgccattgatgtcatcgctcggcgaacacgc
ctgggcttcctgaacgttcaggcggcagacgaagcgctcccacgcatcgttcagatcatg
ggcaaagagctgaactggagtcaggagaaaagaacggaggagctggaagcagcgaagaag
ttcctgtaccatgagatgggttacaggtctcgttccgagcagcttaccaagacatctgag
atcaacctcgactaccaggaagtcgtccggtacaagaagcgcttccacaagtttgacaag
gagaagaaaggcttcatcaccacagtggacgtccagagagttttagagagcatcaacgtc
cacatcgacgaaaatgctcttcacgaaatccttaatgaggtggacctgaacaagaacgga
caagtggagattgatgagttcctgcagctgatgagcgccgtgaagaagggaaaagtgtcc
gacagccggctggccatcctcatgaaaacagccgaagagacgctggacgagagggggccg
gtgacggtggaccgcagtgggggcggagtctga

DBGET integrated database retrieval system