KEGG   Nothobranchius furzeri (turquoise killifish): 107384762
Entry
107384762         CDS       T05163                                 

Definition
(RefSeq) uncharacterized protein LOC107384762
  KO
K05461  KIT ligand
Organism
nfu  Nothobranchius furzeri (turquoise killifish)
Pathway
nfu04010  MAPK signaling pathway
nfu04916  Melanogenesis
Brite
KEGG Orthology (KO) [BR:nfu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    107384762
 09150 Organismal Systems
  09152 Endocrine system
   04916 Melanogenesis
    107384762
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:nfu04052]
    107384762
Cytokines and growth factors [BR:nfu04052]
 Growth factors
  Growth factors (RTK binding)
   107384762
SSDB
Motif
Pfam: SCF
Other DBs
NCBI-GeneID: 107384762
NCBI-ProteinID: XP_015813696
UniProt: A0A1A8V827
LinkDB
Position
sgr01
AA seq 253 aa
MRKEIFNTTCFLLSLFSTLNLSSGKFGTPITDDVSKLSILKQNIPSDYEIPVTFIPKEVA
GTCWVVLNIYPLEQSLRKLSNMFGAVSSNKDNLIVFVAMLKSLRFTFDHEELETAMQVFQ
CHYQEENLLSGLYFDYIQDLLHAASQGTSGFSCKPPPCINRRLTPDGHEESRSSSWSKRT
PLLLVLIPFAACVVLIVWQVRSGGHLPVCNPLNGQREAPDRIPTVSISIPLQTLTHASEI
QPAREAISEHESG
NT seq 762 nt   +upstreamnt  +downstreamnt
atgaggaaggaaatcttcaacacaacttgtttcctcctgagtctgttttcaactttaaac
ctctcttctgggaaatttggaaccccaataactgatgatgtgagcaagctgtcgatactg
aagcagaacatcccctctgattatgagattcctgtcactttcattcccaaagaagtggct
ggcacctgctgggtggttttaaatatctatcctctggagcaaagtcttcgaaaactgtcc
aacatgtttggtgccgtctcctccaacaaagataacctaatcgtctttgtcgccatgttg
aaaagcctacgtttcacatttgaccacgaagaactggaaacagctatgcaggtcttccag
tgtcactatcaggaggagaacttgctgtctggtctttacttcgactacatccaagacctc
ttacatgcagcctctcaaggaacctcaggcttctcctgcaagccaccaccatgcatcaac
cgtcggctaactccagacggtcatgaggagagtcggagctccagctggtccaaaagaact
cccttacttttggtgctaattccatttgctgcatgcgttgttctgatagtgtggcaggtc
agatctggaggccatttaccagtgtgcaaccctttaaatggccaaagagaagctcctgac
aggatcccaactgtgtctatctccatcccacttcaaacgctcacccacgcctctgaaata
cagccagcgagggaggcaatctctgaacatgaaagtggatga

DBGET integrated database retrieval system