KEGG   Nothobranchius furzeri (turquoise killifish): 107384977Help
Entry
107384977         CDS       T05163                                 

Definition
(RefSeq) protein-glutamine gamma-glutamyltransferase E-like
  KO
K05622  transglutaminase 5 [EC:2.3.2.13]
Organism
nfu  Nothobranchius furzeri (turquoise killifish)
Brite
KEGG Orthology (KO) [BR:nfu00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    107384977
Enzymes [BR:nfu01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.13  protein-glutamine gamma-glutamyltransferase
     107384977
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Transglut_N Transglut_C Transglut_core MG2
Motif
Other DBs
NCBI-GeneID: 107384977
NCBI-ProteinID: XP_015814011
LinkDB All DBs
Position
sgr10
AA seq 757 aa AA seqDB search
MHRVTCQSCRATKSCVFLLGNRFFREMMALDRPNSYSRSNTAVFKGVDLHSRTNNTEHHT
SEISVDQLIVRRGQPFILTLKLAQPFNPDLDQLIMTAETGNYPSETRGTMSRFGVPNKVP
ASASSKAVWKAELQKGSSPETGSLTLTIKPPADAPIGEYKLSAKHKEEEQVLANLSVLFN
PWCSDDWVFQPDDEQRQEYVMNEHGVIYRGVDNYISQMHWDFAQFEEDMVKICVKILDMN
LKHKRDPAEDVSARCNPIYVSRVVTSMINNANFGGILQGSWGSDFRGGVPPSHWSGSYAI
LKQWYSSFYSSVKYGQCWVFAGVMCSVMRLLGIPCRVVTNYQSAHDTNRNLTVDTYFADY
GVRAKESKDSVWNFHVWVEGWMRRPDLAKNNKYDGWQVLDPTPQEKSDGMFCCGPAPVTA
ILNGDTHLKYDVSFVFAEVNADCVCWLVKKDGTMDKISTDNITVGQNISTKSISSNKRMN
ITDSYKQREGTEQERSVFRYALDRLKSEATGEGDTGGSGEKVLSGTSEMNTTDPVRTAET
NKPSQLIIQFKEDSRPVNGGDVNLKLILSSESTVTRLLSVNISIQAMRYTGQPAGNIQTE
VTEQKLLPGQDLSIPILVPFLTYHKYMIVSQSLNVSVIITDLQNKENIYLAETRIKLMDP
PISITVLGEAVVGRELTAEVMFMNPVKETLRNCTLTLSGSGLFTGEIITNLPDLQPSNRI
RVQFPMFPYRSGERSLMVDFDCSSFRDIKASCTVYVK
NT seq 2274 nt NT seq  +upstreamnt  +downstreamnt
atgcacagagtcacctgtcagagctgcagagccactaagagctgtgttttcttgttgggg
aacagattcttcagagagatgatggcactggacagacccaatagctacagcagatccaac
acagcagtttttaagggagtggacctccacagcaggaccaacaacactgagcaccacacc
agtgagatctctgtggatcagctgattgtgaggcgaggccagcccttcatcctgaccctg
aaactggctcaacctttcaaccctgacctggatcagctcatcatgacagctgagacagga
aactatccatctgagacccgggggacgatgtcacgctttggtgtcccaaacaaagttcca
gcttcagcgtcctctaaggcggtgtggaaggcagaacttcagaagggttcttctcctgaa
acaggaagcttgactctgaccatcaaacccccagcagatgcccccataggggaatacaag
ctgtctgctaaacacaaggaggaggagcaggtgctggctaacctgtcggtgctcttcaac
ccctggtgttctgacgactgggtgttccagcctgatgatgaacagagacaagagtatgtc
atgaatgaacacggggtcatttacagaggggttgataattatatctctcagatgcactgg
gattttgcacagtttgaggaagacatggtgaaaatctgtgtgaaaattctggacatgaac
ctcaaacacaagcgtgaccctgctgaagatgtttctgctcgctgtaatcccatctacgtg
agccgtgtggtcacctctatgattaacaacgcaaactttggaggcatcctgcagggaagc
tggggaagtgacttcagagggggggtgcctccatcccactggagcggcagctacgccatc
cttaagcagtggtacagctctttctactcgtcagtcaaatacggacagtgctgggtgttc
gctggcgtcatgtgttcagtgatgcgtctgctcgggatcccgtgtcgtgtcgtcaccaac
taccagtctgctcacgacaccaacagaaatctgaccgtggacacctactttgctgactac
ggcgtcagagcaaaggaatccaaggacagcgtctggaatttccatgtctgggttgaaggc
tggatgaggcgacctgatctggcaaaaaacaacaaatatgatggatggcaggttctagat
ccaacgccacaagaaaagagtgatggtatgttctgctgtggtccagctccagtcacagcc
atcctgaacggagacactcatctgaaatacgacgtctcatttgtctttgctgaggtcaat
gctgactgtgtttgctggctggtaaaaaaggatggcaccatggacaagatctccactgac
aacataacagttggacagaacatctccaccaagtccatcagctccaataagaggatgaac
atcaccgacagctacaagcagagagaaggaactgagcaggaaagatctgtctttaggtac
gccctggacagactgaagagtgaagcaacaggagaaggagacactggtgggagcggtgag
aaggtcctgagcggaacgtcagagatgaacaccacggaccccgtgcgcacagcggagaca
aacaaaccatcacaacttatcattcagtttaaagaggactccagaccagtcaacggtggg
gatgtgaatctgaagctgattctgagcagcgaaagcaccgtcactaggctgctgtccgtc
aacatcagcatccaggccatgaggtacaccggccaaccagctgggaacatccagactgag
gtgacagagcagaagctgctgcctgggcaagatctgtccatcccgatcctggtcccattc
ttgacctaccataaatatatgatagtgtctcaaagcttgaacgtttcagtcataatcaca
gacctgcagaacaaagagaacatctacctggctgagacccgcattaaactgatggaccca
ccgatctccatcacagttttaggtgaagccgtggtgggccgtgagctgactgcagaagtg
atgttcatgaatccagtaaaggagacactgaggaactgcaccctgactctttctggaagt
ggccttttcactggggagattataaccaaccttccagacctgcagcccagcaacagaatc
cgagtccagttcccgatgtttccctacaggagcggagaaagatctctcatggtggatttt
gactgttcctctttcagggacattaaagccagctgcaccgtctatgttaaataa

DBGET integrated database retrieval system