KEGG   Nothobranchius furzeri (turquoise killifish): 107385135
Entry
107385135         CDS       T05163                                 

Definition
(RefSeq) ras association domain-containing protein 1-like
  KO
K09850  Ras association domain-containing protein 1
Organism
nfu  Nothobranchius furzeri (turquoise killifish)
SSDB
Motif
Pfam: Nore1-SARAH RA C1_1 C1_2 Ras_bdg_2
Other DBs
NCBI-GeneID: 107385135
NCBI-ProteinID: XP_015814296
UniProt: A0A1A8V6H1
LinkDB
Position
sgr10
AA seq 363 aa
MKKRMTNCELIELKDLSVSDPIELAPPALHTTPSPTDPSHPNIYHTVRLTGDTVSIEAPV
HQTGKGASGHNFQPYNYTHLTWCDLCGEFIWGLFRQSLRCANCSYTCHYRCQPFIQLDCS
SHESVSAEKRDYTEDSIETDTNVDEQNEVGKQELSAAAIHRKVKEYNVQINNNLYMVVNK
DKSFTGFIKVHFQLLRPISLPPPPQRQNSTDEEGQQSRRIPRRTSFYLPKDAAKHLHISS
ETQVREVIEALLKKFTVVDNPAKFALFERTEKQSQVSLRKLSDDEHPLLLRLCAGPSEAV
WSLVLKENETGDVNWDAFSLPELSNFLRILQREEEEHTRQIVKRYANARDMMMRAMTHIT
TPG
NT seq 1092 nt   +upstreamnt  +downstreamnt
atgaagaaaagaatgactaactgtgagctgattgagctgaaagacctcagtgtttctgat
cccatcgagctggctcctccggccctccacaccaccccatcacccaccgatcccagtcac
cccaacatttaccacaccgtccgcctgacaggagacaccgtcagcatcgaggcgccagtg
catcaaacaggaaagggcgcttccggtcacaacttccaaccctacaactacacacatctg
acctggtgtgacctgtgtggagaattcatctggggtctttttaggcagagtctgcgctgt
gccaactgcagttacacctgccactaccgctgccaaccgttcatccagctggactgcagc
agccatgagagtgtatcagcagagaaaagagattacactgaagactccatcgagactgac
actaatgtggatgagcagaatgaagtgggtaaacaggagctgagtgctgctgcgattcac
cggaaggtgaaggagtacaacgttcagattaacaacaatctctacatggtggttaataaa
gacaagtccttcactggtttcatcaaggtccacttccagttacttcgccccatctccctg
cctcctcctcctcagcgtcagaactcaacagacgaggagggtcagcagagcagacggata
ccgcggcggacttccttctacctccctaaagatgctgccaagcacctgcatataagctca
gagactcaagtgcgagaagtcatcgaggcgctgctcaagaagttcaccgttgtagacaac
ccagcaaagtttgccttgtttgaacgcacagagaaacaaagtcaagtctccttgcgtaag
ctgtctgatgatgagcatcctttgctattacgtctgtgtgccggtcccagcgaggcagtc
tggagtttggttttgaaagagaacgagacgggggatgtgaattgggatgcatttagtctt
cctgagttgagcaactttctgcgcatcttgcagcgtgaggaagaagagcacacacgtcag
attgtgaagcgctacgctaacgctcgagacatgatgatgcgggcaatgacccacataacc
acacctggttga

DBGET integrated database retrieval system