KEGG   Nothobranchius furzeri (turquoise killifish): 107385163
Entry
107385163         CDS       T05163                                 

Definition
(RefSeq) tomoregulin-2-like isoform X1
  KO
K08774  transforming growth factor, alpha
Organism
nfu  Nothobranchius furzeri (turquoise killifish)
Pathway
nfu04010  MAPK signaling pathway
nfu04012  ErbB signaling pathway
Brite
KEGG Orthology (KO) [BR:nfu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    107385163
   04012 ErbB signaling pathway
    107385163
SSDB
Motif
Pfam: EGF hEGF Laminin_EGF
Other DBs
NCBI-GeneID: 107385163
NCBI-ProteinID: XP_015814341
UniProt: A0A1A7ZWT8
LinkDB
Position
sgr10
AA seq 259 aa
MMWILWDALVLLGGSLFTFGTGPSSSAMIEGNVSITTNATAAPNTSTSSSLTPGKSVFPI
NVPTDQTGFFVPTEAEQISSTVAEALFPANTMSVDDLRDSTSSNSTSTTKRPAGTNNHPV
KKFVAAAVRSHFDDCPDSHQHFCFHGTCRFLIQEETPACVCHPGFVGLRCEHADLLAIVA
TNHRQQAVATVLVLCVIGCVLIMVLCSFLHCWWRQDCRRRSRAHLYVTEKHGVPCYPPES
GTYLHFSHCIKNCMLITFV
NT seq 780 nt   +upstreamnt  +downstreamnt
atgatgtggattctgtgggatgccctggttctgttaggcggttctcttttcacatttgga
acaggtcctagcagctcagccatgattgaaggcaacgtttccatcaccacaaatgccaca
gcagctccaaacacctccactagcagctctttgactcctggcaaaagcgtgtttcctatt
aacgtccctacagatcaaacaggtttctttgttccaactgaagcagagcagataagttca
acagttgcagaggctttgtttcctgcaaacacgatgtcagttgatgatcttcgtgattca
acaagcagcaacagcacttccacaaccaaaaggcctgccgggaccaacaaccatccagtt
aagaagtttgtggcggcggctgttcgctctcactttgatgactgtccagactcccaccaa
catttctgttttcacggcacgtgtcgcttcctgattcaggaagagacgcctgcatgcgtg
tgtcatccaggttttgtcgggttgaggtgtgagcatgcagacctgctcgccatcgtggcg
accaatcacaggcagcaggcagttgccacggtgctggtgctgtgcgtgatcggttgtgtt
ctcatcatggtgctgtgctcattcttacattgctggtggaggcaggactgtcgaaggcga
agtcgtgcacatctctatgtgacagagaagcatggagtgccctgctatcctccagagagt
ggtacttacctccatttttctcattgcataaaaaattgcatgttaatcacatttgtataa

DBGET integrated database retrieval system