KEGG   Nothobranchius furzeri (turquoise killifish): 107385232
Entry
107385232         CDS       T05163                                 

Gene name
rassf1
Definition
(RefSeq) ras association domain-containing protein 1 isoform X1
  KO
K09850  Ras association domain-containing protein 1
Organism
nfu  Nothobranchius furzeri (turquoise killifish)
SSDB
Motif
Pfam: RA Nore1-SARAH C1_1 Ras_bdg_2
Other DBs
NCBI-GeneID: 107385232
NCBI-ProteinID: XP_015814470
UniProt: A0A1A7ZZJ2
LinkDB
Position
sgr10
AA seq 365 aa
MSWGEFIELRDLKSSREQTELIDSRSPCSPTRLERTNALRISPGKVPDLLSRVGIIRVLS
STQDPELPEEKGEGHNFQPCSHAQPTWCDLCGDFIWGLYKQSLRCVNCRFTCHYRCRALI
QLDCIWERFSATDYAAVVEHTIETDTNVDEQTESGKQELTAVEVVHKVKEYNAQVNSNLF
MNVNKDGSYTGFVKVQFKLARPVSVPAPKKGGQDVGGRRSGGVKRRTSFYLPKDASKHLH
ISSRTTSREVIEALLKKFTVVDNPGKFALFERSERHEQVYIRKLSDDERPLRLRLCAGPN
EKVLSFVLKENETGEVNWHAFSMPELKNFLLILQREEEEHVKQIVQRYTLARAKMLEALS
GSTPG
NT seq 1098 nt   +upstreamnt  +downstreamnt
atgtcgtggggtgagttcatcgagcttcgtgacctgaagtcgagcagagagcagacagaa
ctaatagactcccgttcaccatgctcgcctacacggctggagaggaccaacgccctgagg
atcagcccaggaaaggtcccggacctgttaagccgggtgggcatcatccgagtcctgagc
agcacccaggaccccgagcttccagaggagaagggagaaggacacaacttccagccctgc
agccacgctcagcccacgtggtgtgacctgtgtggagatttcatctggggcctgtacaag
cagagcctgcggtgtgtcaactgcagattcacatgccactaccgctgccgtgccttgatt
cagctggactgcatttgggagcgcttctctgcgacggactatgcagctgttgtcgagcac
accatagagacagacacaaatgtggatgagcagacggaatctggaaagcaggaactgacg
gccgtagaggttgtgcataaggtgaaggagtacaacgctcaggtcaacagtaatctattt
atgaatgtgaacaaagatgggtcctacactggctttgtgaaggtgcagttcaagttggca
cgacccgtgtccgttccggctccaaagaaaggaggtcaagatgtgggaggcaggcggtcc
ggtggggtgaagcgccgcacctcattctacctccccaaggatgcatccaagcatttgcac
ataagttcgcgtactacctctcgtgaggtcattgaggctttgttgaagaagttcactgtg
gtggacaatcccggcaagtttgcactgtttgagcgtagcgagcgtcacgaacaagtttac
atccgtaagctctcggatgacgagcgtcccctccgcctgcgtctctgtgctggacccaat
gagaaagttctcagttttgtgttaaaagaaaacgaaactggtgaagtcaactggcatgcc
ttctctatgccggagctgaagaacttcctgctcattttgcagcgtgaagaagaggaacac
gtcaagcagattgtgcagcggtacactttggctcgcgctaagatgctggaggctctatct
ggctctacgcctggctga

DBGET integrated database retrieval system