KEGG   Nothobranchius furzeri (turquoise killifish): 107385235
Entry
107385235         CDS       T05163                                 

Gene name
cacna1c
Definition
(RefSeq) voltage-dependent L-type calcium channel subunit alpha-1C isoform X1
  KO
K04850  voltage-dependent calcium channel L type alpha-1C
Organism
nfu  Nothobranchius furzeri (turquoise killifish)
Pathway
nfu04010  MAPK signaling pathway
nfu04020  Calcium signaling pathway
nfu04260  Cardiac muscle contraction
nfu04261  Adrenergic signaling in cardiomyocytes
nfu04270  Vascular smooth muscle contraction
nfu04912  GnRH signaling pathway
Brite
KEGG Orthology (KO) [BR:nfu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    107385235 (cacna1c)
   04020 Calcium signaling pathway
    107385235 (cacna1c)
 09150 Organismal Systems
  09152 Endocrine system
   04912 GnRH signaling pathway
    107385235 (cacna1c)
  09153 Circulatory system
   04260 Cardiac muscle contraction
    107385235 (cacna1c)
   04261 Adrenergic signaling in cardiomyocytes
    107385235 (cacna1c)
   04270 Vascular smooth muscle contraction
    107385235 (cacna1c)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:nfu04040]
    107385235 (cacna1c)
Ion channels [BR:nfu04040]
 Voltage-gated cation channels
  Calcium channel, voltage-gated (Cav)
   107385235 (cacna1c)
SSDB
Motif
Pfam: Ion_trans CAC1F_C GPHH Ca_chan_IQ PKD_channel
Other DBs
NCBI-GeneID: 107385235
NCBI-ProteinID: XP_015814479
LinkDB
Position
sgr01
AA seq 2282 aa
MVNESKNMYIPEDTLENHQGSDYSPPPPLPRPPPAGLSNEHRGGSSHGDHSGGGGGVNHG
VGMVGLAPEHIPTPGAALSWQAAIDAARQAKMMGNAVSGGGAGLGVGGGGPISTASSTQR
KRQHYTTKPKKQTTTTATRPPRALLCLTLKNPIRRACISIVEWKPFEIIILMTIFANCVA
LAVYIPFPEDDSNATNSNLERVEYLFLIIFTVEAFLKVIAYGLLFHPNAYLRNGWNLLDF
IIVVVGLFSAILEQATKGDGATPIGGKAAGFDVKALRAFRVLRPLRLVSGVPSLQVVLNS
IIKAMVPLLHIALLVLFVIIIYAIIGLELFMGKMHKTCVHNQTDLTAEEKPAPCAPDGAY
GRHCMQNATKCKAGWEGPNDGITNFDNFAFAMLTVFQCITMEGWTDVLYWVNDAVGYKWP
WVYFVTLIIIGSFFVLNLVLGVLSGEFSKEREKAKARGDFQKLREKQQLEEDLKGYLDWI
TQAEDIDPENEEEGLDDDKPRNLSMPASENESVNTDNAPGGDVEGETCCTRLAIRISKSK
FSRYSRRWNRLCRRKCRAAVKSQVFYWLVIFLVFLNTLTIASEHHQQPQWLTDVQDIANK
VLLALFTGEMLLKMYSLGLQAYFVSLFNRFDSFVVCGGILETILVETKIMSPLGISVLRC
VRLLRIFKITRYWNSLSNLVASLLNSVRSIASLLLLLFLFIIIFSLLGMQLFGGKFNFDE
TRRSTFDNFPQSLLTVFQILTGEDWNSVMYDGIMAYGGPSFPGMLVCIYFIILFICGNYI
LLNVFLAIAVDNLADAESLTSAQKEEEEAKERKKLARLTSPEKRTENEKPPIEEKKSEKI
ELKSITSDGEANTATKINIDDCCGDESEEKNPYPANDYIGDDEDDEPEMPVGPRPRPLSD
IQLKEKAVPMPEARAFFVFSHTNKFRVLCHKIVNHNIFTNLILFFILLSSISLAAEDPVK
NDSFRNQILGYADHVFTGLFTIEIILKMTAYGAFLHKGSFCRNYFNILDLVVVSVSLISS
GIQSSAINVVKILRVLRVLRPLRAINRAKGLKHVVQCVFVAIRTIGNIVIVTTLLQFMFA
CIGVQLFKGKFFYCTDSSKQTQAECRGSYITYKDGNVGKPEKALRNWENSDFNFDDVLQG
MMALFAVSTFEGWPGLLYRAIDSHTEDVGPIYNYRVVISIFFIIYIIIIAFFMMNIFVGF
VIVTFQEQGEQEYKNCELDKNQRQCVEYALKARPLRRYIPKNPYQYKVWYVVNSTYFEYL
MFTLILLNTICLAMQHHGQTKNFNDAMNILNMLFTGLFTVEMILKLIAFKPRGYFSDPWN
VFDFLIVIGSIIDVILSEINPADSSSSSSSSSSSSSSSSSSSHPPVVRQMGLQNSEENAR
ISITFFRLFRVMRLVKLLSRGEGIRTLLWTFIKSFQALPYVALLIVMLFFIYAVIGMQMF
GKIALRDHTQINRNNNFQTFPQAVLLLFRCATGEAWQEIMLACSPNRPCEKGSTHENHSS
NEDCGSQFAIIYFVSFYMLCAFLIINLFVAVIMDNFDYLTRDWSILGPHHLDEFKRIWAE
YDPEAKGRIKHLDVVTLLRRIQPPLGFGKLCPHRVACKRLVSMNMPLNSDGTVMFNATLF
ALVRTALRIKTEGNLEQANEELRAIVKKIWKRTSMKLLDQVVPPAGDDEVTVGKFYATFL
IQEYFRKFKKRKEQGLVAKVPPKTALSLQAGLRTLHDIGPEIRRAISGDLNVEEELDKGL
KEPVSAASEDDIFRVKRTGGLFGNHVNYYNQSDGRGSFPQSFTTQRPLHISQKGSPCEGE
SPSHEKLMDSTTFTRSSYSSSSSNANINNANNTSMSGVETQGVSRFPSPSISTVDGHTGQ
PLTPILLPRSAWCFPPKSSDSSDSCLPIIRRGEGSTEETYDESYGDDREYQEDDRSLSSD
MLVCHDETCKQLTPMEEAEEVEERKEGGGGGGGWQSPRRVFLCPTTLGRRASFHLECLRR
QSKPDISQKTAVPLHLVHQQALAVAGLSPLLRRSHSPTLFSRLCSTPPASPTGQCSDASY
QRVPSLRLEGANSHEKLNTSLPSVSCGPWYSDSNGNSPSPAPSMSASSQRAPRPVSLTVP
SLLGKDSISLFHGSAGSLVEAVLISEGLGQFAQDPSFIEATKAELADACDMTIEEMEHAA
NNILNGSTATNTTSSTSSTSQHSPNGSLPFHRVAAAAPHRDRPVGLSPCEAEAAGSRGYV
HEPSSIEERQELLARGRGREDDEEEAEEREERHHRSSVVIAGVQRKNSGLLEDEDMECVT
SL
NT seq 6849 nt   +upstreamnt  +downstreamnt
atggtaaatgaaagcaaaaacatgtacatcccggaagacacccttgagaaccatcaaggc
tccgactactcgcctcctccccctcttcctcgccctcctcccgctggcctgtcgaatgag
cacagaggaggcagtagccatggtgaccacagtggaggagggggaggggttaaccatggg
gtgggcatggttggcctcgccccggagcacattcccacgccgggagcagccctgagctgg
caggcggccattgatgctgcgcggcaggcaaagatgatgggtaacgctgtgtcaggtgga
ggggcgggacttggagtgggagggggcgggcccatttccacagccagttctacgcaaaga
aagagacagcactatactactaaacccaagaaacagaccacaacgacagccacgaggccg
ccgcgggccctactctgtctcacactcaagaaccccatccgccgggcctgcatcagcatc
gtagaatggaaaccatttgagatcatcatcctgatgaccatctttgctaactgtgtggcc
ttagctgtctacatccccttccccgaggatgattccaatgccacaaactccaacctggag
cgtgtggagtatctgttcctaatcatttttacagtggaggcgttcctcaaagtaatagct
tatggcctgctcttccaccccaacgcctacctgaggaatggctggaatctgctcgacttc
atcatcgttgttgtagggttattcagtgcgattttggagcaggccacaaaaggagacggg
gccactcctattggagggaaggcagcaggcttcgatgtcaaggctctgagggccttcaga
gtactccgacccctcaggctggtctctggagtacccagtttacaggtagtgttgaactcc
ataataaaagccatggttcccctgctccacattgccctcctggttctcttcgtcatcatc
atctatgccatcattggcctggaactcttcatgggcaagatgcacaaaacctgcgttcac
aaccaaacagacctcactgcggaggagaagccagcgccgtgtgcgcccgatggagcgtac
ggtcggcactgtatgcagaacgcaacaaagtgcaaagcaggatgggaaggcccgaatgac
ggcatcaccaactttgacaactttgcttttgccatgctgacggtgttccagtgcataacc
atggagggctggacggacgtgctgtactgggtgaatgacgctgtaggttacaagtggccc
tgggtgtattttgtcaccttaatcatcattggatccttttttgtgcttaatttggttctg
ggggtgttgagcggagagttttccaaggaaagagagaaagccaaggcacgtggtgacttc
cagaaacttagagaaaaacagcagctggaggaagacttaaagggctatttagactggatc
actcaggctgaagacatcgacccagagaatgaagaggagggcttagacgatgacaaaccc
agaaacctgagcatgccagccagtgagaatgaatcagtcaacacggataacgccccgggg
ggagacgtggagggggagacttgctgtaccagactagcaattaggatctccaaatccaag
ttcagtcgctattctcggagatggaaccggttgtgtagaaggaagtgtcgtgcagcagtc
aagtcccaggttttctattggttggtcatcttcctggttttcctcaacactctgaccatc
gcttctgaacatcaccagcagcctcagtggcttactgatgtgcaagacatcgccaataaa
gttttactggctctcttcactggagagatgctgctgaagatgtacagtctgggtctgcag
gcgtactttgtgtctctcttcaatcggttcgatagtttcgttgtatgtggggggatcctg
gagacgattctagttgaaacaaagatcatgtctcctctcggcatctctgtgttacgttgt
gtgcgcttgctcagaatcttcaaaataaccagatattggaactctctttccaacctcgtg
gcatcgctgctcaactcagttcgctccatcgcttccctgctgctcctgctcttcctcttc
atcatcatcttctccctgctgggcatgcagctcttcggggggaagttcaacttcgatgag
acccggcgcagcaccttcgacaactttccccagtctctgcttaccgtgtttcagattctg
acaggagaagactggaactcggtcatgtatgatggtatcatggcgtacggtggtccgtct
tttcctggcatgctggtctgcatctattttatcatcctcttcatctgcggaaactatatc
ctgctgaatgtcttcttggccatcgctgtagacaatctggcagatgcagaaagcttgacg
tcggcccagaaagaagaggaggaggcaaaggagaggaaaaaacttgccagactcaccagt
ccagaaaagcgtacggagaatgagaagccacctatagaggagaagaaaagtgagaagatc
gagttgaaatcgatcacctctgatggagaggccaacactgctacaaagataaacatagat
gactgctgtggagatgagagtgaagagaagaacccatatcctgcaaacgattacatagga
gacgatgaggatgatgagcctgagatgcctgtggggccgaggccgcggccgctctctgac
attcagcttaaggagaaggctgttcccatgccggaggctcgtgcattctttgtcttcagc
cacaccaacaaattcagggttctgtgccacaagatcgtcaaccacaacatcttcaccaac
ctcatcctcttcttcatcctgctcagcagcatcagtctggcagcggaggatccggtcaag
aacgactccttcagaaaccagatcctgggctatgcagaccacgtcttcactggactcttc
accatagagatcattttaaagatgacagcctatggagccttcttgcataaaggttcattc
tgtagaaattatttcaacatcctggacttggtggtggtcagtgtgtccctcatctcttct
ggaatacagtctagtgccatcaacgttgtaaagattctgagagtcctgcgagtgctccga
ccactgagagcaatcaaccgagctaaaggcctaaagcacgtggtgcagtgtgtgtttgtg
gccatcaggacaatcggcaacatcgtcatcgtcaccactttgctccagttcatgttcgcc
tgcatcggcgtgcaactcttcaagggcaagttcttctactgtaccgacagctctaagcaa
actcaggctgagtgcaggggttcttacatcacgtataaggatggaaatgtggggaagcct
gaaaaagcgctgagaaactgggagaacagtgatttcaactttgacgatgtcctgcaggga
atgatggctctttttgctgtgtctacctttgagggctggccaggcttactgtaccgagcc
atcgactctcacaccgaggatgtcggccccatctataactaccgtgtggtcatctccatc
ttcttcatcatctacatcatcatcatcgccttctttatgatgaacatcttcgtcggtttc
gtcatcgtcacgttccaggagcaaggagagcaggaatacaagaactgtgagctagacaag
aaccagcgtcagtgtgtggagtatgccctgaaggctcgccctctgcgtcgctacatcccc
aagaacccctatcagtacaaggtgtggtacgtggtcaactccacctactttgagtacctg
atgtttaccctcattcttctcaacaccatctgtctggccatgcagcatcatgggcagacg
aaaaacttcaatgatgccatgaacatcctcaacatgctcttcaccggcctgttcacagta
gagatgatcctcaagctgattgccttcaaacccagggggtactttagtgatccctggaat
gtgtttgatttcctcatcgtaattggcagcataatagacgtcattctcagtgaaatcaac
ccagctgactcctcctcgtcctcgtcctcctcctcttcgtcctcctcttcctcctcttcc
tcctctcacccccctgtggtaaggcaaatgggacttcagaattccgaagagaatgccagg
atatccattaccttcttccggttgttccgcgtgatgaggctggtgaagttgctgtctcgt
ggggaaggaattcgaaccttgctctggactttcatcaaatccttccaggctctgccctac
gtagctctgctcattgtgatgctcttcttcatatacgcagtcatcggcatgcaaatgttt
gggaagatagcgctgcgggaccacacacagatcaacaggaacaacaatttccagacattc
cctcaggccgtgctgctcctcttcagatgtgcaacaggcgaggcgtggcaggagatcatg
ctggcgtgttcacccaatcggccgtgtgaaaaaggctcgacccatgaaaaccactcatcc
aacgaggactgcggcagccagtttgccatcatttactttgtcagcttctacatgctttgt
gcctttctaatcatcaacttgtttgtggctgtaatcatggacaattttgactatctgaca
cgtgattggtcaattttgggaccacatcatcttgacgagttcaagagaatctgggctgaa
tacgaccccgaagcaaagggaaggatcaaacatttggacgtggtcactctgcttcggaga
attcagccccccctcggttttggaaagctctgtcctcacagggtggcatgcaagcggctg
gtgtcgatgaacatgcctctgaacagtgatggaactgtgatgtttaacgccacactgttt
gctttggtcagaacagcactcaggatcaagacagagggtaatctggagcaggcaaatgaa
gaactgagagcaatcgtgaaaaagatctggaaaagaaccagcatgaagcttttggatcaa
gtagtgccccctgctggtgacgatgaggtaacagtcgggaagttctacgctaccttcctc
atccaggaatatttccgcaagtttaagaagaggaaagaacaagggctggtggccaaggtg
cctcccaaaactgccctctctctgcaggcgggcctgcggacgttgcatgacatcggtcca
gagattaggagggccatctctggagacctgaatgtggaggaggagctggacaaaggcctg
aaggagcctgtgtcagcagcatccgaggacgatatcttcagggtaaagcgcactggtggc
ctttttggcaaccacgtcaactactacaaccagagtgatggccgaggatccttcccacag
tccttcactacccagcgtcccttgcacatcagccaaaagggctccccgtgtgaaggcgag
agcccatctcatgagaagctaatggactcgaccaccttcacccgttcctcttactcctca
tcaagctcaaacgccaacattaacaatgccaacaacaccagcatgtcaggggtggagacg
cagggggtcagtcgattcccgagcccatctatcagcactgtggacgggcacacagggcaa
ccgctcacccccatcctgctgccaagatctgcatggtgcttccctccaaagagctcggac
tcgagtgacagttgtctgccaatcatccggagaggggaggggtcaacagaagagacgtac
gatgagagttatggtgacgacagggagtaccaggaagatgaccgctcactttcgtctgat
atgttggtgtgtcatgatgaaacatgtaaacagctgactcccatggaggaagcagaagaa
gtagaggaacgaaaagagggaggaggtggaggaggaggatggcagtctccacgaagagtc
ttcctctgcccaaccactctgggacggagagcatctttccatctggagtgtctccggaga
cagtcaaagccggacatctcccagaagacagctgtacccttacatctagtacatcaacag
gctctggcggtggcagggttaagtcctctgctgagaaggagtcactcacccacactcttt
agccggctgtgctccacgcctccagctagccccacaggccagtgtagtgatgcctcctac
cagcgagttccctctctgagactagagggcgctaactctcatgaaaagctcaataccagc
ttgccttctgtcagctgtgggccatggtatagcgacagtaatgggaacagcccaagccct
gccccaagcatgtccgcatccagtcagagagcgccgcggccggtgtcactaacggtgcca
tcacttttggggaaagactccatctcgctatttcacggcagcgcaggaagtcttgtagaa
gcggttctaatatcagaaggtttgggccagtttgcccaggacccatctttcattgaggcg
accaaagccgagttggccgatgcatgtgacatgaccattgaagagatggagcatgcagcc
aacaacattctgaatggcagcacagccacaaacaccacatccagcacctcttccacctct
cagcacagccctaatggcagcctccccttccacagagtcgcagcagcagcaccacacagg
gaccgacctgtcggcttaagcccctgtgaagcagaggccgcgggaagcagaggctacgtc
catgagccgtcctctatagaggagcggcaggagctgctagccagggggagagggcgagaa
gatgacgaggaagaggcagaagagcgggaagaaaggcatcatagaagctcagtggtgatt
gcaggagtgcaacggaagaacagtgggcttttagaggatgaggatatggagtgtgtgacg
agcttgtag

DBGET integrated database retrieval system