KEGG   Nothobranchius furzeri (turquoise killifish): 107385278Help
Entry
107385278         CDS       T05163                                 

Gene name
park7
Definition
(RefSeq) protein deglycase DJ-1
  KO
K05687  protein DJ-1 [EC:3.5.1.124]
Organism
nfu  Nothobranchius furzeri (turquoise killifish)
Brite
KEGG Orthology (KO) [BR:nfu00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases [BR:nfu01002]
    107385278 (park7)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:nfu04147]
    107385278 (park7)
Enzymes [BR:nfu01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.124  protein deglycase
     107385278 (park7)
Peptidases [BR:nfu01002]
 Cysteine Peptidases
  Family C56: PfpI endopeptidase family
   107385278 (park7)
Exosome [BR:nfu04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   107385278 (park7)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DJ-1_PfpI ThiJ_like GATase_3
Motif
Other DBs
NCBI-GeneID: 107385278
NCBI-ProteinID: XP_015814547
UniProt: A0A1A8AZX4
LinkDB All DBs
Position
sgr10
AA seq 189 aa AA seqDB search
MAGKKALVILSKGAEEMETVIPVDIMRRAGITVTVAGLTGKEPVQCSRNIVICPDTSLEE
ASKQGPYDVVVLPGGMPGAQNLAESPAVKEVLKDQDSRNGLIAAICAGPTALLAHGVGYG
RTVTTHPAMKEKMMAGDHYKYSEARVQKDGHYITSRGPGTSFEFALAIVEEVLGGDFAAQ
VKAPLIMKD
NT seq 570 nt NT seq  +upstreamnt  +downstreamnt
atggcagggaagaaggcgttggtaatcctgtctaaaggtgcagaggagatggaaactgtt
attcctgtggatataatgcgcagagccgggattacagtcacagttgcaggtctgacgggg
aaagagccagtccagtgcagcagaaacattgtcatctgtcctgatacaagtttggaggaa
gccagcaaacagggcccatatgatgtggttgtcttgccaggaggaatgccaggtgctcag
aatctggcagagtcgcctgctgtgaaggaggtgctgaaggatcaagacagcagaaacggc
ctgattgcagccatctgtgcaggccctactgctctcctggcccatggcgtcggctacggc
cgcacagtaaccacacatcctgccatgaaggagaagatgatggctggagaccactataaa
tattcagaggctcgagtgcagaaggatggacattacatcaccagccgtgggccaggaacc
agctttgagtttgccctggccattgtggaagaagttttggggggtgactttgcagctcaa
gtcaaagctcctcttattatgaaagactaa

DBGET integrated database retrieval system