KEGG   Nothobranchius furzeri (turquoise killifish): 107385468Help
Entry
107385468         CDS       T05163                                 

Gene name
pcsk1
Definition
(RefSeq) neuroendocrine convertase 1
  KO
K01359  proprotein convertase subtilisin/kexin type 1 [EC:3.4.21.93]
Organism
nfu  Nothobranchius furzeri (turquoise killifish)
Brite
KEGG Orthology (KO) [BR:nfu00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases [BR:nfu01002]
    107385468 (pcsk1)
  09182 Protein families: genetic information processing
   03110 Chaperones and folding catalysts [BR:nfu03110]
    107385468 (pcsk1)
Enzymes [BR:nfu01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.21  Serine endopeptidases
    3.4.21.93  proprotein convertase 1
     107385468 (pcsk1)
Peptidases [BR:nfu01002]
 Serine Peptidases
  Family S8: subtilisin family
   107385468 (pcsk1)
Chaperones and folding catalysts [BR:nfu03110]
 Intramolecular chaperones
  Subtilisin family
   107385468 (pcsk1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Peptidase_S8 P_proprotein Proho_convert S8_pro-domain DUF1631 Peptidase_S8_N
Motif
Other DBs
NCBI-GeneID: 107385468
NCBI-ProteinID: XP_015814848
UniProt: A0A1A7ZUV1
LinkDB All DBs
Position
sgr10
AA seq 776 aa AA seqDB search
MEVRCRPAVMCCVFAVLCSVVPRSLGASFGDRQYLNEWAVEIPGGMSAAEAIARELDYDL
VRQIGALENHFLFRHQTHPRRMKRSADHITRQLSEDDRVLWAEQQYEKRRSKRAALRSCR
DCSVDKLFDDPMWNQQWYLQDTRTSSSLPKLDLHVIPVWEKGITGKGVVLTVLDDGLEWN
HTDIYSNYDAAASYDFNDNDPDPFPRYDSTNENKHGTRCAGEIAMQADNNKCGVGVAYNS
KVGGIRMLDGIVTDAIEASSIGFNPNHVDIYSASWGPNDDGKTVEGPGRLAQKAFEYGIQ
KGRGGKGSIFVWASGNGGRQGDNCDCDGYTDSIFTISISSASQQGLSPWYAEKCSSTLAT
AYSSGDYTDQRITSADLHNECTQTHTGTSASAPLAAGIFALALEQNPNLTWRDLQHIVVW
TSEFDPLANNPGWKRNGAGLMVNSRFGFGLLNAKALVDLSDPATWTHVPEKKQCIVRDDS
FQPRELKASGEITIEIPTKACVGQENAVHSLEHVQVEASIEYTRRGDLHITLTSPAGTTT
VLLAERERDTSANGFKNWDFMSVHTWGEDPAGIWTLKITDTSGHMENKGRILNWKLILHG
TSEKPKHMKKPRVYIPYNAVQNDRRGVEHMDDMMEEPTQARPPQRAESEHASSSNPEKEP
KLPSNSLSSPSLALLRLLQTAFNRHAAASQQPRATPRPFPSMWSNQQPARDIFPPPPTKF
PAQKLYQALDLINKYSGPEDSLYSDYSDGFYNTKPYRHRDDRLLQALFEMLDDDQK
NT seq 2331 nt NT seq  +upstreamnt  +downstreamnt
atggaagtgagatgtcgtccagcggtgatgtgctgtgtgtttgccgtcctctgctccgtg
gttccccgctcgctgggcgcatctttcggggacagacagtacctgaacgagtgggcagtg
gagatcccgggcggtatgtccgccgccgaggccatcgccagggagttggactacgatctg
gtccgacagattggggccctggaaaatcatttcttgttcagacaccaaacgcacccccgc
agaatgaaacgtagcgctgaccacatcaccaggcagctgtctgaggatgatcgggtgctc
tgggccgagcagcagtatgaaaagcggcgcagtaagagagcggcgctcaggagctgtagg
gactgttctgtggacaaactgttcgatgaccccatgtggaaccagcagtggtacctgcaa
gacacgcggacgtcgtcctcactgccgaagctagacctgcacgtcatcccagtgtgggag
aagggcatcaccgggaagggagtggtcctcaccgtcctcgatgacgggctggagtggaac
cacacagacatctactccaactacgacgctgctgccagttacgatttcaacgacaacgac
cccgacccatttcccagatacgactccaccaatgaaaacaagcacggcaccaggtgtgca
ggagagattgcaatgcaggccgacaacaacaagtgtggtgttggagtggcgtacaattca
aaggttggaggaatccgtatgctggatggaattgtgacagacgccatcgaagcgagctcc
atcggatttaatccgaaccatgtggacatctacagcgccagctgggggcccaatgacgac
gggaagactgtggaggggcctggtcgtctggctcagaaggcttttgaatacggcattcag
aagggccgtggtggaaaaggctccatctttgtttgggcatcaggtaacggcggtcgccag
ggcgataactgtgactgtgatggctacacagacagcatcttcaccatctcaatcagcagc
gcctcccagcagggcctgtccccgtggtacgctgagaagtgctcctccactctggctaca
gcgtacagcagcggagactatactgaccagaggattacaagtgctgatcttcacaatgag
tgcactcagactcacaccggcacttcagcttctgccccgctggctgctggcatatttgcc
ctggcgctggaacaaaatccgaatcttacctggagagacctgcagcacatcgtggtctgg
acctcagagtttgaccctttagccaataacccaggctggaagaggaacggagcaggactg
atggtcaacagccgttttggctttggacttctcaacgccaaagctctggtggacctctct
gacccagccacgtggacgcacgtaccggaaaaaaaacagtgcatcgtcagggatgattct
tttcagccaagagagttaaaagcatcgggagagatcaccatagagattcctaccaaagcc
tgcgtgggacaggagaacgccgttcactcgctggagcatgttcaggtggaggccagtatc
gaatacacccggagaggagatctgcacatcacactcacctcccctgccggcaccaccaca
gttctactggcagagcgagaaagggatacctcagccaatggtttcaagaattgggacttc
atgtctgttcatacttggggagaagatcctgcgggaatctggaccttaaagatcacagat
acttcgggccatatggagaacaagggacgaatcttgaactggaagctgattctccacgga
acatcagagaaacccaagcacatgaagaaacctcgagtgtacattccgtacaacgcagtg
cagaacgaccgccgaggtgtggaacatatggatgacatgatggaggaacccacacaggcc
cgcccacctcagagggctgagtctgaacacgcctcttcctccaatccagagaaggagccc
aaactcccctcaaactccctctcttccccctctctggccctgctgcgtctcctgcagacg
gcgtttaaccgacacgccgccgcatcgcagcagccccgcgccacgcccaggcccttcccc
tccatgtggagcaaccagcagccagcccgggacatctttcctcctcctcctacaaaattc
ccagcccaaaagctgtaccaagctctggacttgatcaacaagtacagtggccccgaggac
agtctgtacagcgactacagcgacggcttctacaacaccaaaccatacaggcacagagac
gaccggctgctgcaggccctgtttgagatgctggatgatgaccagaagtga

DBGET integrated database retrieval system