KEGG   Nothobranchius furzeri (turquoise killifish): 107385781Help
Entry
107385781         CDS       T05163                                 

Gene name
sdhb
Definition
(RefSeq) succinate dehydrogenase [ubiquinone] iron-sulfur subunit, mitochondrial
  KO
K00235  succinate dehydrogenase (ubiquinone) iron-sulfur subunit [EC:1.3.5.1]
Organism
nfu  Nothobranchius furzeri (turquoise killifish)
Pathway
nfu00020  Citrate cycle (TCA cycle)
nfu00190  Oxidative phosphorylation
nfu01100  Metabolic pathways
nfu01200  Carbon metabolism
Module
nfu_M00009  Citrate cycle (TCA cycle, Krebs cycle)
nfu_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
nfu_M00148  Succinate dehydrogenase (ubiquinone)
Brite
KEGG Orthology (KO) [BR:nfu00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    107385781 (sdhb)
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    107385781 (sdhb)
Enzymes [BR:nfu01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     107385781 (sdhb)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Fer2_3 Fer4_17 Fer4_8 Fer4_10 Fer4_9 Fer2 Fer4_7 Fer4_18
Motif
Other DBs
NCBI-GeneID: 107385781
NCBI-ProteinID: XP_015815371
UniProt: A0A1A8AAY2
LinkDB All DBs
Position
sgr10
AA seq 283 aa AA seqDB search
MSVASFTSLSRCGVMAFRSPARQLAVRYAQTAAAPSVQPRIKKFQIYRWDPDTPGDKPRM
QTYEVDLNACGPMVLDALIKIKNEMDSTLTFRRSCREGICGSCAMNINGGNTLACLNKID
ANLSKPTKIYPLPHMYVVKDLVPDMSNFYAQYKSIEPYLKKNDESKEGKEQYLQSVEDRQ
KLDGLYECILCACCSTSCPSYWWNGDKYLGPAVLMQAYRWLIDSRDDFTEQRLSKLQDPF
SLFRCHTIMNCTQTCPKGLNPGKAIAEIKKMMATYKEKKAAAV
NT seq 852 nt NT seq  +upstreamnt  +downstreamnt
atgtcagtcgctagtttcacgtccttgagtcgctgtggtgttatggcattccgctcgccc
gcgaggcaactggcggtgcggtacgcccaaacagcagcagctccttctgttcagcccagg
ataaagaagttccagatctatagatgggacccggacacacctggagacaaaccccgcatg
cagacatatgaggttgacctcaacgcttgtggcccgatggttcttgatgccctcatcaag
attaaaaatgagatggactcgactctgaccttccgcaggtcttgtagagaaggtatttgt
ggatcctgtgcaatgaacataaatggaggaaacacactcgcctgtctcaacaagattgat
gcaaacctcagcaagcccaccaagatttaccctctgccacatatgtacgtggtcaaggac
ctggtacctgacatgagtaacttctacgctcagtacaagtccattgaaccatacctgaag
aagaatgatgagtctaaagaagggaaggagcagtacctgcagtctgtggaggacagacaa
aagctggacggcctgtatgaatgtattttgtgcgcctgctgcagcacgagttgtccgagc
tactggtggaacggagacaaataccttgggcccgctgtgctcatgcaggcatatcgttgg
ttaatcgactcaagagatgacttcacagagcagcgactctccaagctgcaggatcctttt
tctctctttcgctgccacaccatcatgaactgcacccagacctgcccaaagggcctgaac
ccaggaaaagccattgctgagatcaagaagatgatggccacgtacaaggagaagaaggca
gcagctgtctga

DBGET integrated database retrieval system