KEGG   Nothobranchius furzeri (turquoise killifish): 107386707
Entry
107386707         CDS       T05163                                 

Gene name
fgf1
Definition
(RefSeq) fibroblast growth factor 1 isoform X1
  KO
K18496  fibroblast growth factor 1
Organism
nfu  Nothobranchius furzeri (turquoise killifish)
Pathway
nfu04010  MAPK signaling pathway
nfu04810  Regulation of actin cytoskeleton
Brite
KEGG Orthology (KO) [BR:nfu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    107386707 (fgf1)
 09140 Cellular Processes
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    107386707 (fgf1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:nfu04052]
    107386707 (fgf1)
   00536 Glycosaminoglycan binding proteins [BR:nfu00536]
    107386707 (fgf1)
Cytokines and growth factors [BR:nfu04052]
 Growth factors
  Growth factors (RTK binding)
   107386707 (fgf1)
Glycosaminoglycan binding proteins [BR:nfu00536]
 Heparan sulfate / Haparin
  Growth factors/receptors
   107386707 (fgf1)
SSDB
Motif
Pfam: FGF Fascin eIF-6
Other DBs
NCBI-GeneID: 107386707
NCBI-ProteinID: XP_015816758
LinkDB
Position
sgr11
AA seq 179 aa
MDGEETESPPRSSQVQEHCLASTTPSGMSEGEVTVFQLVPVTPDLSKLGQRSLIKLYCRN
GGHHLRILPDGTVNGGTRENDPYETLRLTSVSAGMVVIKGETTGRYLAMNKNGLLYGSQT
LNDECYFLENFEENNYNTYRSQKYCWYVALKRNGQPKLGPSTHSGQKAILFLPRSTSNV
NT seq 540 nt   +upstreamnt  +downstreamnt
atggatggagaagaaactgaatctcctcctcggtcttcacaggtccaggaacattgtctt
gcatctacaactccatctgggatgtctgagggagaagttactgtgtttcagctcgtccca
gtgactcctgacttgtccaagctggggcagcgctcactcatcaagctctactgtcgaaac
ggaggacatcatctgaggattttaccagatgggacagtaaatggtgggacgcgagagaat
gacccttatgaaaccttgcggctgacgtctgtgagtgcaggaatggtagtcatcaaaggc
gagacgacaggaaggtatctggctatgaacaaaaatggacttctctatggatcacaaaca
ctgaacgacgagtgttacttcctggagaatttcgaagagaacaactacaacacgtatcgc
tctcagaaatactgctggtatgttgccttgaagaggaacggtcagcccaaactgggaccg
tccacccactcgggtcagaaagccatcctttttctgccaaggtctacaagcaacgtttga

DBGET integrated database retrieval system