KEGG   Nothobranchius furzeri (turquoise killifish): 107386954Help
Entry
107386954         CDS       T05163                                 

Gene name
sod1
Definition
(RefSeq) superoxide dismutase [Cu-Zn]
  KO
K04565  superoxide dismutase, Cu-Zn family [EC:1.15.1.1]
Organism
nfu  Nothobranchius furzeri (turquoise killifish)
Pathway
nfu04146  Peroxisome
Brite
KEGG Orthology (KO) [BR:nfu00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04146 Peroxisome
    107386954 (sod1)
Enzymes [BR:nfu01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     107386954 (sod1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Sod_Cu
Motif
Other DBs
NCBI-GeneID: 107386954
NCBI-ProteinID: XP_015817146
UniProt: A0A1A8VAP1
LinkDB All DBs
Position
sgr11
AA seq 153 aa AA seqDB search
MVVKAVCVLKGADKTAGTVHFEQENESAPVKVTGEISGLADGEHGFHVHVYGDNTNGCIS
AGPHFNPFDKNHGGPADEERHVGDLGNVTAEGNVAKINITDSVIKLSGPLSIIGRTMVIH
EKRDDLGKGGNEESLKTGNAGARLACGVIGIAQ
NT seq 462 nt NT seq  +upstreamnt  +downstreamnt
atggtggtgaaagctgtgtgtgtgttgaagggagctgacaaaacagccgggaccgttcac
tttgagcaagagaatgaatcggcccctgttaaagtgactggggaaatcagtggccttgct
gatggtgaacatggtttccacgtccatgtatatggggataacacaaatggttgcattagc
gcggggcctcacttcaatccttttgacaagaatcacggcggtcctgcagatgaagaaaga
catgttggagacctggggaatgtgactgctgaagggaatgttgccaagataaacatcaca
gacagcgtcatcaaactctcaggacctctctcaatcattggtcgaaccatggtgatccac
gagaagcgtgacgatctaggaaaaggaggaaacgaagaaagcctgaagactggaaatgct
ggagctcgtctagcctgtggcgttattggcatcgcccagtaa

DBGET integrated database retrieval system