KEGG   Nothobranchius furzeri (turquoise killifish): 107387955Help
Entry
107387955         CDS       T05163                                 

Definition
(RefSeq) protein ADP-ribosylarginine hydrolase-like
  KO
K01245  ADP-ribosylarginine hydrolase [EC:3.2.2.19]
Organism
nfu  Nothobranchius furzeri (turquoise killifish)
Brite
KEGG Orthology (KO) [BR:nfu00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    107387955
Enzymes [BR:nfu01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.2  Hydrolysing N-glycosyl compounds
    3.2.2.19  [protein ADP-ribosylarginine] hydrolase
     107387955
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: ADP_ribosyl_GH DUF2378
Motif
Other DBs
NCBI-GeneID: 107387955
NCBI-ProteinID: XP_015818732
LinkDB All DBs
Position
sgr12
AA seq 356 aa AA seqDB search
MDRSVTEEHYVAAMVLSGVGDAVGYKRGEWEFNKSGPSIHKELQKLGGLKNIKVQLPEWP
VSDDTVLHLATAEGLATGKTDEELLHEVAARYVEGMRDMEDRAPGFTTVNSVSQLRPGEE
GGYRVPYNPRGAGCGAAMRSMCIGLRYPKPEQLSSLVAVAVETGRMTHNHPTGFLGSVAS
AVFTAYAVQRRPITTWGLGLINEACPIARKFVQDRGFAVEETERDWSYFCDKWQWYLDQR
GISNGEGPVIWPSTYGPAERDEVYHSFSLSGWAGACGHDAPMIALDALLGAGSDWEELMS
RAAFHGGDSDSTAVIACCCWGVLHGFQGVPKGNYCNVEYRHRLELCAKQLYTLSQQ
NT seq 1071 nt NT seq  +upstreamnt  +downstreamnt
atggaccgatctgtcacagaggagcattatgtagcagccatggtgctgagtggtgttggt
gatgctgtgggctacaagagaggggagtgggagttcaataagtctggaccttctatccac
aaggagctgcagaagctcggtggcttgaagaacatcaaagttcagcttcctgagtggccg
gtgagcgacgacacggttctgcatctggcaacggctgaagggttggcgaccgggaagact
gatgaggagctgctgcatgaggtggctgctcgttacgtggaggggatgagagacatggag
gacagggcgccagggtttaccactgttaactctgtttctcaactgaggcccggagaggaa
gggggctacagagtgccgtataacccccgcggggcaggctgtggagcagctatgaggtcc
atgtgcattggtctcaggtatccaaaacccgaacaactgtcatcacttgtggctgttgcc
gtggagacgggcaggatgacccacaatcaccccactggtttcctgggctcggtggcatcg
gccgtttttacggcctacgccgtccagcgccggcccatcaccacctggggtctgggtctg
atcaacgaggcgtgtcccatcgccaggaagtttgttcaggatcggggcttcgctgtggag
gagacggagagagactggagctacttctgtgacaagtggcagtggtatctggaccagagg
ggcatctctaacggtgaggggcctgtgatctggccgtccacctacggtccagcggagagg
gatgaggtctaccatagcttcagtctgtccggttgggcgggagcctgcggacacgatgct
ccgatgatagcgctggacgctcttctgggagccggctcagactgggaggagctgatgagc
agagctgctttccacggaggtgacagcgacagcacagctgtgatcgcctgctgctgctgg
ggtgtcctccacggcttccagggggtccctaagggaaattactgcaacgtggagtaccgg
caccgactggagctctgcgccaagcagctctacaccctgtcacaacagtaa

DBGET integrated database retrieval system