KEGG   Nothobranchius furzeri (turquoise killifish): 107388107Help
Entry
107388107         CDS       T05163                                 

Gene name
ace
Definition
(RefSeq) angiotensin-converting enzyme
  KO
K01283  peptidyl-dipeptidase A [EC:3.4.15.1]
Organism
nfu  Nothobranchius furzeri (turquoise killifish)
Brite
Enzymes [BR:nfu01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.15  Peptidyl-dipeptidases
    3.4.15.1  peptidyl-dipeptidase A
     107388107 (ace)
Peptidases [BR:nfu01002]
 Metallo Peptidases
  Family M2
   107388107 (ace)
Exosome [BR:nfu04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   107388107 (ace)
CD molecules [BR:nfu04090]
 Proteins
  107388107 (ace)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Peptidase_M2
Motif
Other DBs
NCBI-GeneID: 107388107
NCBI-ProteinID: XP_015818980
LinkDB All DBs
Position
sgr12
AA seq 1289 aa AA seqDB search
MGGGGVDRLVKSLLLLLPVLLRCEALPESWQPGNYINSTADAQRFLRDYNSTAEEVFFLS
VLASWNYNTNLTEHNSKLQVSAALEEQAFSEAWGMKAKQVFSKELLDSLPDAEDKMLMEG
IMQLGAANLPQNEREEFNTILSTMDSIYSTAKVHPQPNISWSLEPELTDIMAKSRSYKKL
LYAWEAWHNESGVPLKEYYPRFVELSNKASRGDGFNDTGAEWRSWYETPTFEQDIEKLYR
TIEPLYLNLHAFVRRKLYNFYGPRYINLKGPIPAHLLGNMWAQTWNNIFDMMVPFPDKPN
VDVTAEMVKQGYNATHMFRVAEEFFTSLDLAEMPKEFWEGSMLVKPEDREVVCHASAWDF
YNRKDFRIKQCTTVTMEQLFTVHHEMGHIQYYLQYKDQPVGFRDGANPGFHEAIGDVLSL
SVSTPKHLHKINLLESATSDEETDLNFLLKMALEKIAFLPFGYLIDQWRWGVFDGRTPPD
KYNSEWWYLRTKYQGICPPTKRTEDHFDPGAKYHIPGNTPYIRYFISFILQFQFHEKLCE
AANHTGPLHTCDIYQSAEAGAILKKVLQAGSSKPWPDVLQEAIGTREMNANSLMKYFEPV
TKWLQEQNVKETLGWPEFNWVPPIPEGYPEDVDKNTDELHAKTFLEEYNRTAEVTWNAYT
EASWNYNTDLTESNKKIMLQKNLEMSKHTLKYGLKAREYDTTDFQDTSVKRIIKKLSDIE
RAALSSAELEEYNTLLSNMETKYSLAVVCRDGVTCHPLDPDLQKIMAESRDYDELLFAWK
GWRDSAGKILRQDYKRYVELANKAATINGHSDNGAFWRSLYETPTFEEDLETLWKELEPL
YLNVHAYVRRALYRNYGPDYINLKGPIPAHLLGNMWAQTWSGIMDLVTPYPDATQVDATP
AMVAQGWNATRMFQESDRFFTSLGLLPMPKEFWDKSMLEKPTDGRQVVCHASAWDFYNRK
DFRIKQCTVVTMDDLITVHHEMGHVQYFLQYKDQPVSFRDGANPGFHEAIGDVLALSVST
PKHLQSIGLLDKVEDNHESEINFLMSMALDKIAFLPFGYLMDQWRWKVFDGRIPSTEYNK
EWWNLRLKYQGLCPPVLRNEDDFDPGAKFHIPANVPYVRYFISFIIQFQFHKALCDAAKH
NGPLHMCDIYKSHEAGKLLGDAMKLGNSKPWPEAMAMITGQSKMSAQPLMTYFKPLIDWL
EVENNKNNDVRGWPEYDWKPATRPGVEIKDVKVDFLGMNVDGAAAVAGQWILLVLGLVLL
VATILLAYKYRKSKRPEKSLSTMELKQKD
NT seq 3870 nt NT seq  +upstreamnt  +downstreamnt
atgggtggaggtggtgtggacaggttagtaaaatctctgctgctgcttctgccagtgctg
ctgcgctgtgaagcactgccagagagctggcagcctggaaactacatcaacagcacggcc
gacgcgcagaggttcctcagagattacaacagcactgctgaggaggtgttcttcctcagt
gtgttagccagctggaactacaacacaaacctaacggaacacaactccaagctccaggtt
agtgcagctctagaggaacaagccttctctgaggcctgggggatgaaggccaagcaggtc
ttttctaaggagcttcttgactccctccctgatgctgaagacaagatgttgatggagggc
atcatgcagctgggagctgctaaccttccccagaatgaaagagaggagttcaacaccatt
ctcagcaccatggatagtatttattcaacagcaaaggtacacccacagccaaacataagc
tggagcctggaacccgagctaacagacatcatggccaaatccaggagctacaagaagttg
ctctatgcttgggaagcctggcacaatgagtctggcgtgcctctaaaggagtattacccc
aggtttgtcgagctcagcaacaaagcctctagaggagatggattcaatgacactggagca
gaatggcgctcttggtacgagactccaacttttgaacaggatatagaaaagctctacagg
accatcgagccactttacctgaacctgcatgcatttgtgcgccgcaaactctacaacttc
tatggacccagatatatcaacctgaagggaccgattcctgcacacctgctgggaaatatg
tgggcccagacctggaacaacatctttgacatgatggtcccatttcctgacaaacccaac
gtggatgtgacggctgaaatggttaaacaaggctacaatgctacacacatgttccgtgtg
gccgaggagttcttcacctccttggatttagcagaaatgcctaaagaattctgggaaggt
tctatgcttgttaagcctgaggatcgagaggtagtgtgtcacgcgtctgcctgggacttt
tacaaccgcaaagacttcaggattaagcagtgcaccacagtgaccatggagcagctcttc
actgttcaccatgagatgggacacatccaatattacttgcagtacaaggaccagcctgtg
ggctttcgcgatggagccaaccccggatttcacgaagccatcggtgatgttctgtcactt
tctgtttcgaccccaaagcacctgcacaaaattaacctgctagaatctgcaacctctgac
gaagaaactgaccttaatttcctgttgaagatggctctggagaagattgccttccttcct
tttggttacctcattgaccagtggagatggggggtatttgatgggcgcacccctccagat
aaatacaactctgagtggtggtacctcagaaccaaataccaaggaatttgcccgcccacc
aagcgtacagaggaccactttgatcctggtgcaaaataccacatccctggaaatacacca
tacatcaggtattttatcagcttcatcctgcagttccagtttcacgagaagctgtgtgaa
gcagccaatcacactggccctctgcacacatgtgacatctaccagtctgcagaagcagga
gccattctaaagaaagttcttcaggctggctcttccaaaccttggcctgatgtgctccag
gaggccattggcaccagagagatgaatgccaactcactaatgaaatactttgagcctgta
acaaagtggctgcaagaacaaaatgtgaaagagactctgggatggcctgaatttaactgg
gtcccacccattcctgagggctacccagaggatgtagataagaatacagatgagctccat
gcaaagacgtttctagaagagtataaccgaacagctgaagtgacttggaatgcatacaca
gaggcttcttggaactacaacacagacctcactgaatctaataagaagatcatgctccag
aagaacctggagatgtcgaaacataccctgaagtacggactaaaggctcgcgagtacgat
accacggacttccaggatacttccgttaaacgcatcatcaaaaaactcagtgacattgag
agggctgctctgtcctcagcagagctggaagagtacaacacccttctatctaacatggag
actaagtacagtctggctgtggtttgcagagatggtgtcacctgccatccactggatcca
gatctccagaagatcatggcagagtccagggactacgatgagctgctgtttgcttggaaa
ggatggagagattctgctggcaaaattcttcgtcaggattataaaagatatgttgaactg
gccaacaaagctgccacaatcaacggtcattctgataatggagctttttggcggtctctg
tatgaaactccaacttttgaggaggacctggagactctgtggaaggagctggagcctctc
tatctgaacgtacatgcatatgttcgaagggctttgtacagaaattatggtcctgactac
atcaacctgaagggaccaattcctgctcatctgttgggcaacatgtgggctcagacctgg
tctgggattatggatttagtcacaccctacccagatgccacacaggtggatgctactcca
gctatggtggcacagggttggaacgccacccggatgttccaggaatcagacagatttttc
acctctctgggcttgttgcccatgcccaaagaattctgggacaaatccatgttggagaaa
ccgactgatggacgccaggtggtgtgccatgcctctgcttgggacttctataatcggaaa
gacttcaggattaaacagtgcacggttgtgactatggatgacctgatcacggtgcaccat
gagatgggccatgttcagtacttcctgcagtacaaagaccagcctgtgtcctttcgtgat
ggagccaaccctggtttccatgaggccattggagatgttcttgcactgtcagtgtccacg
cccaaacacctgcagagcatcggccttctggacaaagttgaggacaaccacgaaagtgaa
atcaactttttgatgagcatggccctcgacaagattgccttcctaccttttggctacctg
atggaccagtggaggtggaaggtgtttgatggacgcatcccttcaactgaatataacaaa
gaatggtggaacctcagattgaagtaccagggactgtgtccacctgtacttcgcaatgag
gatgactttgacccaggtgctaagttccacatccctgcaaatgtgccctacgtcaggtac
ttcattagcttcatcatccagtttcagttccacaaggctctgtgtgatgctgcgaagcat
aacgggccactgcacatgtgtgatatctacaaatctcacgaagctgggaagctgctgggc
gacgcaatgaagcttggtaacagtaagccctggcctgaagccatggccatgatcactggt
cagtccaaaatgtccgcccagcccctcatgacatatttcaaaccgctcatcgattggctg
gaggtggagaacaacaagaataacgatgtccgcggatggcccgagtatgactggaaacct
gcaacaaggcctggagtggaaatcaaagatgtcaaagtagacttcctgggaatgaatgtg
gatggtgctgctgcagtagctggtcagtggatcctgctggttcttggtctggtcctccta
gtggccaccatcctactagcatacaaatacagaaagtcaaaaaggcctgagaagtcctta
tcaactatggagctgaagcagaaggactag

DBGET integrated database retrieval system