KEGG   Nothobranchius furzeri (turquoise killifish): 107388428
Entry
107388428         CDS       T05163                                 

Gene name
cdkn1b
Definition
(RefSeq) cyclin-dependent kinase inhibitor 1B
  KO
K06624  cyclin-dependent kinase inhibitor 1B
Organism
nfu  Nothobranchius furzeri (turquoise killifish)
Pathway
nfu04012  ErbB signaling pathway
nfu04068  FoxO signaling pathway
nfu04110  Cell cycle
Brite
KEGG Orthology (KO) [BR:nfu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    107388428 (cdkn1b)
   04068 FoxO signaling pathway
    107388428 (cdkn1b)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    107388428 (cdkn1b)
SSDB
Motif
Pfam: CDI
Other DBs
NCBI-GeneID: 107388428
NCBI-ProteinID: XP_015819440
UniProt: A0A1A8V829
LinkDB
Position
sgr13
AA seq 180 aa
MSNVRVSNGSPTLERTEARVSEHPKPSACRSLFGPVDHEELKKDFNEHMREFKEAAAAKW
GFDFASDTPLSNGRFKWELVDSEEMPDFYHRQPRREKGVCPRSTSVDLNGNHNCVLVASS
GDTSKPDGQTECTGLRKRPASHEPPTQNKRSHTSPDEVSCPNLSHSVEHTPRKPSPKRQT
NT seq 543 nt   +upstreamnt  +downstreamnt
atgtctaatgttcgagtttcaaacgggagtccgacgttggagcggacggaggcccgggtg
tcggagcacccgaagccgtctgcctgcagaagtctgttcggcccggtggatcacgaagag
ttaaagaaggattttaacgaacacatgcgggagttcaaagaggctgccgctgccaagtgg
ggcttcgacttcgccagtgacacgccactgagcaacggcaggttcaaatgggaactagtg
gattccgaggagatgccggacttctaccaccggcagccgcggagggagaagggcgtctgc
cccaggagcaccagtgtggatctaaacgggaaccataactgcgtcctggtggcgtcgagc
ggggataccagcaagcccgacggtcaaacggagtgcaccgggctgaggaagagacctgct
agtcacgagcctccgacccaaaacaagaggtcccataccagcccagacgaggttagctgt
ccgaacctgagccactcagtagaacacacacccagaaagcccagtcccaagagacagacg
tga

DBGET integrated database retrieval system