KEGG   Nothobranchius furzeri (turquoise killifish): 107389057Help
Entry
107389057         CDS       T05163                                 

Definition
(RefSeq) lysosomal alpha-glucosidase-like
  KO
K12316  lysosomal alpha-glucosidase [EC:3.2.1.20]
Organism
nfu  Nothobranchius furzeri (turquoise killifish)
Pathway
nfu00052  Galactose metabolism
nfu00500  Starch and sucrose metabolism
nfu01100  Metabolic pathways
nfu04142  Lysosome
Brite
KEGG Orthology (KO) [BR:nfu00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00052 Galactose metabolism
    107389057
   00500 Starch and sucrose metabolism
    107389057
 09140 Cellular Processes
  09141 Transport and catabolism
   04142 Lysosome
    107389057
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:nfu04147]
    107389057
Enzymes [BR:nfu01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.20  alpha-glucosidase
     107389057
Exosome [BR:nfu04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   107389057
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_hydro_31 NtCtMGAM_N Trefoil Gal_mutarotas_2 DUF5110
Motif
Other DBs
NCBI-GeneID: 107389057
NCBI-ProteinID: XP_015820420
UniProt: A0A1A8AE23
LinkDB All DBs
Position
sgr02
AA seq 974 aa AA seqDB search
MVSYKKLNPEDVRFSSSVLSEDARPVQQDKVSDPDRVSLLPHRPSCSITTSVVVIGCILM
LLGVGWVLYTMYWLHSPSSQHSYGPLPPAPGKASGSRLRAEVNRIPSSSHKEACNVISEP
WRFDCYPERGVVVTQELCEARNCCFIPTSSASTSAPSQSRKNGIPWCFYPLDFPSYSLVS
LNETSMGVKGTLVKGGTTYYPGDILTVEMEICHETDTRLHVRITDPSSSRYEVPISVPAA
AKKAENPEYLVELTKQPFGLIVRRRSTGAVLLNTTVAPLFYTDQFLQFSTSLASPYIYGL
GEHRSTFLHDVRWNTLTMWARDVPPMEQTNLYGVHPFYLTMEAGGTAHGFFLLNSNAMDV
VLQPAPALTWRTIGGILDFYVFLGPDPGSVVEQYVDVIGRPAMPIYWALGYHLCRWGYNS
SDSTWEVVKSLRNYGIPHDTQWNDIDYMDQFKDFTFDPTNFDSLPDLVRDLHAHNQTYVI
MLDPAISSTQPKGSYWPFDEGLKRGVFMKDAEGKPLIGKVWPGQTAFPDFSDEVTHEWWF
DNLRKFHEKVPFDGLWIDMNEPSNFVDGSMNGCPTNSLENPPYTPGVLGGFLRSKTVCAS
VQQKQSTHYNLHSLYGLMEAKASASALKRILSKRPFVISRSSFPSQGLYSGHWLGDNRSQ
WKDLYTSITGILTFNLFGIPLVGADICGFSEEPQEELCVRWTQLGAFYPFTRNHNTVGMK
PQDPTAFSPLAREAMKQALLLRYSLFPFLYTLFHHAHLHGHTVARPLMFEFPGDVKTYGI
DKQFLWGRSLLVTPVLEPGVDFVGGYFPPGLWFDYFTGDSVRSKGEELRLDAPLDKINLH
LREGSITPTQAPNLTLWISSGQPLHLVSALSDDGSASGDLFWDDGESLDTYETNQYTYIV
FSVSQKAMTSQVLHSSQEASFLSVDSTSFYGVPEKPSRVLVNTREVPFTYRDNQVLTVTG
LGLSLAQNFTISWM
NT seq 2925 nt NT seq  +upstreamnt  +downstreamnt
atggtttcatacaagaagctgaacccggaagatgttcggttttccagctcagttttatca
gaagatgctcgtccagttcaacaagacaaagtttcagatccagaccgtgtttccttgctc
cctcatagaccatcatgctccatcaccacgagtgttgtggttattggctgcattctgatg
ctccttggtgtaggctgggtgttgtacaccatgtactggctacacagtccatccagccaa
cattcatatggaccactgccgccagctccggggaaagcatcaggatccagattacgagca
gaagtaaacagaattccatcctcctctcacaaagaggcctgcaatgtaatctcagagccg
tggaggtttgattgttaccctgaaagaggtgttgttgtgacgcaagagttgtgtgaagca
agaaactgttgctttatccctacatccagtgcttctacttctgctcccagccagtcaagg
aaaaatggtattccttggtgtttctatcctctggattttccctcttactcactggtgtct
ctaaatgagacatcaatgggtgtaaaaggtacacttgtaaagggagggacgacttactac
cctggagacattctcactgttgagatggagatatgccatgaaacagacacaagactgcat
gtcagaatcacagacccctccagttcacggtatgaggttcccatctcggtgcccgccgct
gctaagaaggcagaaaacccagagtacctcgtggagctcacaaagcagccatttggtctc
atagtgaggaggagatccaccggagccgtgcttctgaataccacagtggctcctctcttc
tacacggaccagttccttcagttttccacctctctggcatctccatacatttatggcttg
ggtgaacaccgctccacctttttgcacgatgtccgctggaacacgctcaccatgtgggct
agagatgttcctcccatggagcagacaaacctgtacggagtccatccattttatctgact
atggaggcgggagggactgctcacggcttcttcctgctcaacagtaatgcaatggacgtg
gtcctccagcccgccccagcccttacttggagaactattggtggaatccttgacttctac
gtgttcctgggtcctgatcctgggtcagtggttgagcagtatgtggacgtcataggacgc
ccagccatgcccatctactgggctttaggataccacctctgtcgctggggatacaactcc
agtgattccacctgggaagttgtcaagagcctgaggaattatgggataccccatgacacc
cagtggaacgacatcgactacatggaccagttcaaggacttcacttttgacccaacaaac
tttgactctctccctgacctcgtcagggatctgcatgctcacaaccagacttatgttata
atgctggacccagctatcagcagcacgcaacccaagggctcatactggccgttcgatgag
ggactgaagagaggagttttcatgaaagatgctgaggggaaaccacttattggaaaggtg
tggcctggtcagacagctttccctgacttttctgatgaagtcacacatgaatggtggttt
gacaacttgcgcaaattccatgagaaagtcccttttgatggattgtggattgacatgaac
gagccctcaaactttgtggacggatcaatgaacggctgtccgacaaatagtcttgaaaac
cctccttacaccccaggtgttttaggaggttttctgaggtctaaaactgtgtgtgcctca
gtgcagcagaaacagtccacacattataatcttcacagtctctacggactcatggaagct
aaagcctctgcaagtgctctgaagcggattttgtcaaagcgaccttttgtgatctcccgc
tcctccttccccagtcagggtttgtactctggtcactggctgggagacaacaggagccag
tggaaggacctttacacttctatcacaggtattttgacctttaacctatttggcatcccg
ttggtgggagcagatatctgcggcttcagtgaggaaccgcaggaggagctgtgtgtccgt
tggacccaactgggagcgttctatcccttcactcgaaaccacaacactgttggcatgaag
cctcaggacccaacagctttcagccctctggcccgtgaagccatgaaacaagctctgctg
ctcagatactccctcttcccgttcctctacaccctgtttcatcacgcgcacctacacgga
cacaccgttgcacgtccactgatgtttgagtttccaggagatgtgaaaacctacgggatc
gacaaacagttcctgtggggaaggagcttattagtgactccagtgttggagcccggggtg
gactttgtgggaggttacttcccaccaggtctgtggttcgactacttcacgggggattct
gttcgcagcaaaggtgaagaactacgactggacgcgccgctagataagatcaacctgcat
ttgcgtgaaggttctatcacaccaactcaggcgcccaacctgaccttgtggataagcagc
ggtcagcctcttcatctggtctcagctctgtctgatgatggttcagcttctggagatctg
ttctgggatgacggagagagcctggacacctacgagaccaaccagtacacctacatcgtc
ttcagcgtctctcagaaagcgatgacctcccaggtgctccatagcagccaggaggcctca
ttcttgtctgtggactcgacgtctttctacggtgtccccgagaagccgagcagagtgctg
gtgaacacccgtgaagtcccattcacctacagagacaaccaggtattgaccgtcacaggt
ctgggtctcagcctcgctcagaacttcaccatcagctggatgtaa

DBGET integrated database retrieval system