KEGG   Nothobranchius furzeri (turquoise killifish): 107389755
Entry
107389755         CDS       T05163                                 

Definition
(RefSeq) lysophosphatidic acid receptor 2-like
  KO
K04291  lysophosphatidic acid receptor 2
Organism
nfu  Nothobranchius furzeri (turquoise killifish)
Pathway
nfu04080  Neuroactive ligand-receptor interaction
nfu04810  Regulation of actin cytoskeleton
Brite
KEGG Orthology (KO) [BR:nfu00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    107389755
 09140 Cellular Processes
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    107389755
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:nfu04030]
    107389755
G protein-coupled receptors [BR:nfu04030]
 Rhodopsin family
  Lipid
   Lysophosphatidic acid
    107389755
SSDB
Motif
Pfam: 7tm_1 7TM_GPCR_Srsx DUF1634 7TM_GPCR_Srv DUF962
Other DBs
NCBI-GeneID: 107389755
NCBI-ProteinID: XP_015821580
UniProt: A0A1A8AD40
LinkDB
Position
sgr02
AA seq 366 aa
MAYPDKDGCYRNYSVKFFYEESGKNISDYWRKRDYLVVSLGLTVSFIVIFSNLLVIAAIF
KNRRFHYPIYYLLGNLAVADLFSGVSYLYLMFHTGPWTIKLTIVQWFVRQGLIDTSLTAS
VLNLLAVAVERHQTIFNMQLHSSMSIRRVFLIILLIWVVSIGMGLIPNMGWNCLCNLETC
STMAPMYSRSYLIFWAVLNLLTFSIMVAVYMRIFFYVRHKNRQMSQHTSQNRYRETVMNL
MKTVSMILGLFVVCWTPGLVVLLLDGLNFDKIVVLTLEKYCLVLAECNSFVNPIVYCFRD
SDMRKTFERVLCCLCKRGNNQNGKSEAPFAYTETEHHTVRKKGDNNGTVLIRRDADNNPV
ASEGFL
NT seq 1101 nt   +upstreamnt  +downstreamnt
atggcatatcctgacaaagatggatgctacagaaactactcagtcaaatttttttatgag
gagagtggcaaaaacatcagtgactactggcgcaagcgagactatctggttgtcagtttg
ggtttgactgtttccttcatagttattttttccaacctcttggtcatcgctgccattttt
aaaaacaggcgctttcactatcccatctactacctgttaggtaatctggctgtagcagac
ttgttttcaggtgtctcctatctctacttgatgtttcatactgggccctggaccataaag
ctgactatagtccagtggtttgtgcgtcagggtctgattgacaccagcctcacagcctcg
gtcctcaatcttctggcggtggctgtggagcgtcaccagaccatattcaacatgcagctg
cacagctcaatgagcatacgccgggttttccttatcatcttgttgatctgggtggtgtcc
atcggcatgggcctgattcccaacatgggatggaactgcctgtgcaacctggaaacatgc
tctaccatggcaccaatgtacagccgcagctacctgattttctgggctgttctcaacttg
ctgaccttctccatcatggtggccgtctacatgcggatctttttctatgtgcggcacaag
aacaggcagatgtctcaacacacaagccagaacagatacagagagactgtgatgaacctg
atgaagaccgtttcaatgattctagggctgtttgtcgtctgctggacgcctggcctcgtc
gtgctgctgctcgacggtctgaattttgataagatcgtggtgttgacactggagaagtac
tgcctggtgctggccgagtgcaactcttttgtcaaccccatcgtctactgcttcagggac
tccgacatgaggaagaccttcgagagagtcctgtgctgcctgtgcaagaggggcaacaat
cagaacggcaaatccgaagctccatttgcctacactgagacagagcaccatactgtccgg
aaaaaaggggacaacaacgggactgttctcatacgccgagatgcggacaacaacccagta
gcgtcagagggcttcctgtaa

DBGET integrated database retrieval system