KEGG   Nothobranchius furzeri (turquoise killifish): 107390031Help
Entry
107390031         CDS       T05163                                 

Gene name
gad1
Definition
(RefSeq) glutamate decarboxylase 1
  KO
K01580  glutamate decarboxylase [EC:4.1.1.15]
Organism
nfu  Nothobranchius furzeri (turquoise killifish)
Pathway
nfu00250  Alanine, aspartate and glutamate metabolism
nfu00410  beta-Alanine metabolism
nfu00430  Taurine and hypotaurine metabolism
nfu00650  Butanoate metabolism
nfu01100  Metabolic pathways
Module
nfu_M00027  GABA (gamma-Aminobutyrate) shunt
Brite
KEGG Orthology (KO) [BR:nfu00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    107390031 (gad1)
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    107390031 (gad1)
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    107390031 (gad1)
   00430 Taurine and hypotaurine metabolism
    107390031 (gad1)
Enzymes [BR:nfu01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.15  glutamate decarboxylase
     107390031 (gad1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pyridoxal_deC Aminotran_5 Beta_elim_lyase SepSecS BTRD1
Motif
Other DBs
NCBI-GeneID: 107390031
NCBI-ProteinID: XP_015821995
LinkDB All DBs
Position
sgr14
AA seq 593 aa AA seqDB search
MASAPSSSSSFGGEADPNATNLRPPGSSYDAWCGVAHGCTRKLGMKICGFLQKNNSLEER
SRIVSSIKERATKDLLSCDNTGGDARFKRIETDFSNLYARELLPAKNGEEPTMQFLLEVV
EILTSYIKKTFDKSTKVLDFHYPHQLLEGIEGFSLELPDQPESLEQILVDCRDTLKYGVR
TGHPRFFNQLSTGIDIVGLAGEWLTSTANTNMFTYEIAPVFVLMEQLTLKKMREIVGWPN
GEGDGIFSPGGAISNMYSVMIARYKYFPEIKTKGMAAAPRLVLFTSELSHYSIKKASAAL
GFGTDNLILLNTDERGRVIPADLESKVTEAKQKGYVPVYVNATAGTTVFGAFDPINDIAD
ICEKYNMWLHVDAAWGGGLLMSSKHRHKMSGIHRANSVTWNPHKMMGVPLQCSAILVRER
GLLQGCNSMCAGYLFQPDKHYDVTYDTGDKAIQCGRHVDIFKFWLMWKAKGTVGFEQQID
KCLDLSAYLYSKIKNREGFQMVFNGEPQHTNVCFWYLPLSLRHLPDGEEKRERLHKVAPK
IKAMMMESGTTMVGYQPQGDQVNFFRMVISNPAATRSDIDFLVEEIERLGQDL
NT seq 1782 nt NT seq  +upstreamnt  +downstreamnt
atggcgtctgcaccctcctcctcctcctcctttggcggcgaagcggatccaaacgcgaca
aatttacggccgccaggctcaagctatgatgcgtggtgtggagttgctcatggatgtacc
cgaaaattgggaatgaaaatatgtggattcctgcagaagaacaacagtttggaggagagg
agcaggatcgtgagctccatcaaggagcgcgcgaccaaagatctgctgtcctgcgataac
accggaggggacgcgcggtttaagcgcatagagaccgacttctccaatttgtatgccaga
gagcttttgcctgccaaaaatggagaagagcccaccatgcagttcctgctggaggtggtg
gaaatcctcaccagctacatcaagaagacttttgacaaatccaccaaggtccttgacttc
cactatcctcaccagctgctggagggcatagagggcttcagtctggagctgcccgaccag
cccgagtctctggagcagatcctggtggactgcagggacaccctgaaatatggcgtgaga
acaggccaccccaggttctttaaccagctgtctactggaatagacatcgtgggattggcg
ggagagtggctcacttccacagccaacacaaacatgtttacatatgagattgccccagtt
tttgtgctgatggagcagctgacgctcaaaaagatgagggagatcgttggctggccaaac
ggagaaggcgatggaatattctctccaggaggagccatttccaacatgtacagtgtgatg
atcgccagatacaagtacttccccgaaatcaagaccaaaggcatggcggctgcacctcgg
ctagtgctcttcacgtcggagctgagccactactccatcaagaaggcgagtgcagcgctg
ggatttgggacagacaacctgatccttctaaacacagacgagagaggaagagttattcct
gctgatttggagtccaaagtaactgaggccaaacaaaagggatacgttccggtgtatgtg
aacgccaccgcagggaccaccgtgttcggagcctttgaccccatcaacgacatcgcagac
atctgtgaaaagtacaacatgtggcttcatgtggacgctgcatggggaggaggtctgctg
atgtccagcaaacacagacacaagatgagcggaatccacagggctaactcagtcacctgg
aaccctcacaagatgatgggagtgcctctgcagtgttctgccattctggtccgagagagg
gggctgttgcaaggctgcaactccatgtgtgcaggttacctcttccagccagacaaacat
tacgatgtcacgtacgacacaggagacaaggccatccagtgtggacgacacgtcgacatc
tttaagttttggctcatgtggaaggcaaagggaacggtgggatttgagcagcaaattgac
aagtgcctggacctgtcagcatacctctacagtaaaattaaaaacagagaaggcttccag
atggtgttcaatggagagccacagcacactaatgtctgcttttggtaccttccgctgagc
ctgcgccacttgcccgatggtgaggaaaaacgcgagagactgcacaaggtggctccaaag
atcaaggcgatgatgatggagtcgggcaccacgatggtgggttaccagccacaaggagac
caggtcaacttcttccgcatggtgatctccaaccctgctgccaccaggtcagacattgac
ttcctggttgaggagatcgagcggctgggccaggacttgtag

DBGET integrated database retrieval system