KEGG   Nothobranchius furzeri (turquoise killifish): 107391543
Entry
107391543         CDS       T05163                                 

Gene name
ikbkg
Definition
(RefSeq) NF-kappa-B essential modulator isoform X1
  KO
K07210  inhibitor of nuclear factor kappa-B kinase subunit gamma
Organism
nfu  Nothobranchius furzeri (turquoise killifish)
Pathway
nfu04010  MAPK signaling pathway
nfu04210  Apoptosis
nfu04620  Toll-like receptor signaling pathway
nfu04621  NOD-like receptor signaling pathway
nfu04622  RIG-I-like receptor signaling pathway
nfu04623  Cytosolic DNA-sensing pathway
nfu04625  C-type lectin receptor signaling pathway
nfu04920  Adipocytokine signaling pathway
nfu05132  Salmonella infection
nfu05168  Herpes simplex virus 1 infection
Brite
KEGG Orthology (KO) [BR:nfu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    107391543 (ikbkg)
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    107391543 (ikbkg)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    107391543 (ikbkg)
   04621 NOD-like receptor signaling pathway
    107391543 (ikbkg)
   04622 RIG-I-like receptor signaling pathway
    107391543 (ikbkg)
   04623 Cytosolic DNA-sensing pathway
    107391543 (ikbkg)
   04625 C-type lectin receptor signaling pathway
    107391543 (ikbkg)
  09152 Endocrine system
   04920 Adipocytokine signaling pathway
    107391543 (ikbkg)
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    107391543 (ikbkg)
  09172 Infectious disease: viral
   05168 Herpes simplex virus 1 infection
    107391543 (ikbkg)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:nfu01001]
    107391543 (ikbkg)
Protein kinases [BR:nfu01001]
 Serine/threonine kinases: Other
  IKK family [OT]
   107391543 (ikbkg)
SSDB
Motif
Pfam: NEMO CC2-LZ zf_C2H2_10 DUF4111
Other DBs
NCBI-GeneID: 107391543
NCBI-ProteinID: XP_015824370
LinkDB
Position
sgr15
AA seq 615 aa
MVQPQPDGPMQWDMSGEDCGGVLRVPPEFAGNEVVTRLLCDNQQLREALRRSNQALRQRC
EEMEGWQRKTREEREFLSLRFQEARALVERLAQENHSLQSMMNGPASSSNLSGSSSQTED
LQGRPSRNGLVDGPQTLDQWERKRVDESEQQTQTTPLRSLPVEGANEFLQLLKSHKEKTE
EGTRELKRKTEELERRNEELMKKMAEGEEDKEQMRRCIDHLRSKLLQAQASGGAEETVLL
RSEAQHSSDCLGLAKLTEQLQATQGRYRELEEKLDYLQKSSAQRDRTEALLKQKDKDCAQ
LSKDCETLKVQVTSLLGELNERQSCLEKSDHERKILEEKLVSKVKSLQAAERELEQLKKQ
HHVAKDKLLLQVQSLEQALKTERHVVTEERKKLTQLQHAYTCLFRDYDAKLKNEVNKVAD
TRPALLLLCRLWSLLQEGDLSSRLEEAERALALKQDTIDKLKEEVEQQKGSLETVPVLTA
QAEIYKADFLAEREAREKLNQKKEELQEQLTQSLAENDRLKQEALSRERMEQMKLRHMKD
FQPRPLHIPPPQGVFPGGTFNTVPAAPSFRNQALVPVSDQGAAGNEELPDLCCPKCHYLA
PDMDTLQIHVMDCIQ
NT seq 1848 nt   +upstreamnt  +downstreamnt
atggtgcagccgcagcctgatggtccgatgcagtgggacatgtcaggagaggactgcggg
ggggtcctcagggtcccaccagagttcgctggtaatgaagtggtgaccagattgttgtgt
gacaaccagcagcttcgagaggctctgcggcggagtaaccaggccctgcgtcagcgctgt
gaggagatggagggatggcagcgtaaaaccagggaggagcgggagtttctcagccttcgt
ttccaggaggcccgggccctggtggagagactggcccaggagaaccactccttacagagc
atgatgaacggaccggcttcctcctctaacctctccggcagctccagccagactgaagac
ctacagggacgcccgtccagaaacgggctggtggacggaccacagactctggaccagtgg
gagaggaaacgggtcgatgaatcagaacagcagactcagaccaccccgctccgcagcctg
cctgtggagggcgccaacgagttcctgcagctgctgaagagccacaaagagaaaacagag
gaagggacgagagaactgaagaggaagaccgaagagctggagaggagaaatgaggagctg
atgaagaagatggcggagggagaggaagacaaagagcaaatgcggcgttgcatcgaccat
cttcgatccaaactgctgcaggcgcaggctagcggcggcgccgaggaaaccgttctgctt
cgctctgaggcgcagcattcctccgactgtttgggcttggctaagctcacagagcagctc
caggccactcagggcaggtaccgggagttggaggagaagctggactacctgcagaagagc
tcggcccagcgagacagaaccgaagctctgctcaagcagaaggacaaggactgtgcccag
ctctccaaagactgtgagactctgaaggtgcaggtaacctccctgttaggagaactgaac
gagaggcagagctgcctggagaaaagcgatcacgagcgcaaaattctggaggagaagctg
gtcagcaaggtgaagtccttgcaggcagcagagcgggagctggagcagctgaagaagcag
caccatgtggccaaggacaagctgctgctgcaggtccagagcttggagcaggcgctgaag
acggagagacacgtcgtgaccgaggagaggaagaagctgacgcagctgcagcacgcctac
acctgcttgtttagagactacgatgccaaactgaagaatgaggtgaataaagtcgcagac
acacgcccagcgttgcttctgttgtgccgactctggtctctcctacaggagggagatctc
agcagccgactggaggaggcggagcgagcgctggcgctcaagcaggacaccatcgataaa
ctgaaggaggaggtggagcagcagaaaggctcgctagaaaccgtccctgtcctcactgca
caggctgagatctacaaggcagatttcctcgcagagcgggaagcgagagaaaagctgaac
cagaagaaagaggagctgcaggaacagctcacgcagtccttggctgagaacgaccggctg
aagcaggaagccctgtcacgggagcgaatggagcaaatgaagctgagacacatgaaagac
ttccaacctcgacccctccacatcccgcccccacaaggagtgtttcctggtggaaccttc
aacacagtgccggccgccccctccttcaggaaccaggctttggtgccggtcagtgaccag
ggtgcagcaggaaacgaggagctgcctgatctatgttgtcccaagtgccattacttggct
ccagacatggatacactgcagatacatgtcatggactgtatacagtag

DBGET integrated database retrieval system