KEGG   Nothobranchius furzeri (turquoise killifish): 107391864Help
Entry
107391864         CDS       T05163                                 

Gene name
ganc
Definition
(RefSeq) LOW QUALITY PROTEIN: neutral alpha-glucosidase C
  KO
K12317  neutral alpha-glucosidase C [EC:3.2.1.20]
Organism
nfu  Nothobranchius furzeri (turquoise killifish)
Pathway
nfu00052  Galactose metabolism
nfu00500  Starch and sucrose metabolism
nfu01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:nfu00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00052 Galactose metabolism
    107391864 (ganc)
   00500 Starch and sucrose metabolism
    107391864 (ganc)
Enzymes [BR:nfu01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.20  alpha-glucosidase
     107391864 (ganc)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_hydro_31 Gal_mutarotas_2 DUF5110 NtCtMGAM_N
Motif
Other DBs
NCBI-GeneID: 107391864
NCBI-ProteinID: XP_015824827
LinkDB All DBs
Position
sgr16
AA seq 921 aa AA seqDB search
MADDNQPVFSEVPDDKGKEKYKKSENVAFYRRQMQGPSRKYRALLDTMVLTEKGVCFQLV
EADTQTKLLLTVSPCKCDTVRILIDEAQPGKARYRVSDVLTGDPQSEQLRVESQTQDFVT
LSWSLAQHQVRVWHFPFRVEILKDQEVIVTFNSKGKLWFERLQAAQVRSTETCSDSDKEC
YKRHLVLCLLSGTSSDGREPTDDPTGLWRETFRTFVDIKANGPSSIGADLCLHGFRHAYG
LPEHSDQLLLRDTRDGEPYRLYNLDVFAYDLHSRLGLYGSVPLMVAHRADRTIGVFWLNA
SETFVNLQYLPTDPQMPPVKRRRTQVQTDVHWLSESGVIDCMVLLGPSPHQLFHQYAQLT
GYQALPPFFALGYHQCRWNYDDEADVRAVDAGFDRHNIPYDVIWLDIEHTDGKRYFTWDS
ARFPEPAKLQRHLEKKNRKMVVISDPHIKVDADWSLYREARDGGHFVRDREGHIYQGSCW
PGESSYVDFSSTATRAWYSTCFSLEKYKGSTSVLFVWNDMNEPSVFSGPEQTLPKDAVHH
GGWEHRDLHNLYGFYQHMATADGLLTRSGGSERPFVLSRSFFAGSQRFGAIWTGDNVASW
DHLKISIPMVLSLSLAGIVFCGADVGGFVQDPEPELLVRWYQAAALLPFFRGHSDKKTKR
REPWLFGEEVTAAIRAAVQQRYHLLPYWYTLFHYAHNSGLPPVRPLWTEFPREEHTFTED
SQYMIGGALLACPVTQPGVEEVRVLLPGSNEIWYDICSGQEYGGGQTLSLPVTLDTIPVF
QRGGSVVCRSTGSGTCAADFQQLPLTLTVALNCQGRAAGELYLDDGHSFGYRVRKSRLRR
FCLRSGCLRCSPAADDGTFDCETFIQSVTVLGLRDKPSTVVVHVSGAEETSAVFEYEETC
CRLTVTRLKLSVLMDWQVQMS
NT seq 2766 nt NT seq  +upstreamnt  +downstreamnt
atggcggatgataatcagcccgtttttagtgaggtccctgatgataaagggaaggagaag
tacaagaaaagtgagaatgttgctttttacaggagacagatgcagggtcccagcaggaag
tacagggcccttttagacaccatggtgctcactgagaagggagtctgcttccagctggtg
gaagctgacactcagaccaagctgcttcttactgtgtctccctgtaaatgtgacactgtg
aggatcttgatagatgaggctcagcctggtaaagcccgctaccgagtctctgatgtgctg
actggagatcctcagagtgaacagttgagggtggagtcacagactcaggattttgtcacc
ctttcctggtctctggcacaacaccaggtccgcgtgtggcattttcctttccgagtggag
atcttgaaggatcaggaagtgatcgttacgtttaactccaaaggcaaactgtggtttgaa
aggttgcaggctgcccaggtgaggtccacagagacatgttcagattcagacaaagagtgt
tacaaacggcatcttgttttgtgtttgctctctggaacctcgtctgatggcagggagcct
accgatgacccgacaggtttatggagggagaccttcaggacgtttgttgacatcaaagct
aacggtccgagcagcatcggcgctgatctctgccttcacgggttcagacacgcctacggc
cttccagaacactccgaccagctgctgctcagagacaccagagacggagaaccttatcgg
ctgtataacctggacgtgtttgcctacgacctgcacagccgcctgggcctgtacggctcc
gtaccgctgatggtggctcatagagcagacaggactatcggtgtgttttggctgaatgcg
tcggaaacctttgtgaaccttcagtacctccctacagacccccagatgcctccagtgaag
aggaggaggacacaggttcagactgacgtccactggctctcagagagcggggtgatcgac
tgcatggttttactggggcccagcccacatcaactgttccaccagtacgcccagctgaca
ggttaccaagccctgccccccttctttgccctggggtaccaccagtgccgctggaactac
gacgacgaggccgacgtgagggctgtggatgctggattcgatcgccataacatcccttat
gatgtcatctggctggacatcgagcacactgatgggaagcgatacttcacctgggactcg
gctcgtttccccgaaccggcaaaactacagcgccatctagagaagaagaataggaagatg
gtggtgataagtgatccccacatcaaggtggatgctgattggtccctgtaccgtgaggcc
agagacggaggacactttgttcgagacagagaaggacacatctatcagggctcgtgttgg
ccaggtgagtcttcctatgttgacttcagcagcactgcgacccgagcctggtactccacc
tgcttcagtctggagaaatacaaggggtcgacctccgtcctctttgtatggaacgacatg
aacgagccgtcggtcttcagtgggccggagcagacgctgccgaaggacgcggtgcatcac
ggaggatgggaacatcgggatctacacaacctgtacggcttctaccagcacatggccaca
gcggacggcctgctgacccgctcagggggctcagagagaccctttgtcctctctcgctcc
ttctttgcaggatctcagagatttggagcaatatggaccggcgacaacgtggccagctgg
gaccatctgaagatttccattcccatggttctgtctctgagtctagcggggatcgtgttt
tgcggagctgatgttggggggttcgttcaggatccagaaccagagctgttggtgcgctgg
taccaggcggcggccctgctgccgttttttcggggccactcagacaagaagaccaagcgg
cgtgagccctggctctttggggaggaagtcacagcagcgatccgcgccgccgtccaacag
aggtaccatttgctgccctactggtacactctgttccactacgcccacaactccggcctg
cctccagtcagacctctgtggaccgagtttcccagagaagaacatacgttcactgaggac
agtcaatacatgattgggggagccttgctcgcctgtcctgtaacacagccaggagttgag
gaggtcagagtcttacttcctggatctaatgaaatctggtacgacatctgctctggacag
gaatatggaggaggccagactctgagtcttccagtcaccctggacaccattccggtgttc
cagcgcggcggctcggtggtctgtagatcaacaggaagtgggacatgtgcagcggacttc
cagcagcttcctcttactctcaccgtggccttaaactgtcagggccgtgctgcaggtgaa
ctctacctggacgatggtcattcctttggttaccgggtcagaaagtcccgtctgcgccgg
ttctgcctgcggtcgggctgcctgcgctgcagccctgctgcagatgatggaacgtttgac
tgcgagacgttcatccagtccgttactgtcctgggtttgagagacaaaccatccacggtt
gtcgtccatgtgtcgggtgctgaggagacgtctgctgtgtttgagtatgaggagacctgc
tgcaggctgacggtgacccgcctgaagctcagcgttctgatggactggcaggtccagatg
agttaa

DBGET integrated database retrieval system