KEGG   Nothobranchius furzeri (turquoise killifish): 107391900Help
Entry
107391900         CDS       T05163                                 

Definition
(RefSeq) histone-lysine N-methyltransferase NSD2-like
  KO
K11424  histone-lysine N-methyltransferase NSD2 [EC:2.1.1.43]
Organism
nfu  Nothobranchius furzeri (turquoise killifish)
Pathway
nfu00310  Lysine degradation
Brite
KEGG Orthology (KO) [BR:nfu00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00310 Lysine degradation
    107391900
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:nfu03036]
    107391900
Enzymes [BR:nfu01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.43  histone-lysine N-methyltransferase
     107391900
Chromosome and associated proteins [BR:nfu03036]
 Eukaryotic Type
  Histone modification proteins
   HMTs (histone methyltransferases)
    HKMTs (histone lysine methyltransferases)
     107391900
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PWWP SET PHD zf-HC5HC2H zf-HC5HC2H_2
Motif
Other DBs
NCBI-GeneID: 107391900
NCBI-ProteinID: XP_015824889
LinkDB All DBs
Position
sgr16
AA seq 1303 aa AA seqDB search
MDGIGSSLPLMPEPANPVSMKQPPESLCVRKGHGDMGSDPTLLMDKAAAQLAATLQDSVL
QKMAGHSHNNHNHERLKSLTSLVLNGDQDVLPKLCTPDPPMLQGAEAPDATHQSNCTPLS
EPELKVTIPQVVKQLSYEPSYAKGTSLVTASEGALSGHDERPDVMNRRGRAHKPKALLNC
SSSVIAMDSLDHTDTVDDTRAADEHALMLELVEQSKEESPLQASFSVGDLIWAKVSGYPW
WPCMVTTDPEFSVHIKQKQKETNGRLGPFYHIQYFGDAPERGYIFEKNMVSFTGENQYLE
LSQSSKAAASCSVRRKRTPSIPRKLQAQWNMGIIQANEALSMTPEKRIENFVFFYDDDGP
HLNPRILEKLKPDQSNVMMLESEHSPDLLSLLKFTTSAPCVKAEPAVPQKKDGSKDVQPP
TKSGRRTKLSPVNRTHDPMRKTKMKLVSFRGMGSKGASLQAPVRRERKKLTDDATNEDQQ
PNRRCKTSKNTEKQVSGLEDTNDKKRRKKKNDLKEGKEPRKQTVKSKGLLNDELNADKPK
RHRKRKQDGENQNTASKAKRRRSSPCPNPEGSGSEERPDSPSDSLDGIKKSERKKEFVCQ
MCEKAGEDMVSCEGQCCGMFHLHCLGLSLKPDDKLLCPECSSGAHSCFICKQLEGEVRRC
HVPHCGKFYHESCVRLNPLTMFDNKGFRCPLHACLSCHYGSQTRPKSTKGRLMRCLRCPV
AYHVGDLCVAAGSEMITNTAIICTNHFNAKKSYSHHSHVNVSWCFVCSKGGQLLCCESCP
AAFHPDCLNIAMPDGSWFCNDCQAGKKPKYRDIIWVKLGTYRWWPAEIHHPKNIPTNIQH
LRHEIGEFPVFFFGSKDYFWTHQGRVFPYMEGDRGSKNRRKGIGKVFKNALLEAEARFKE
VKMKREAKEAQEISRKPPPYKFIKVNRPFGRVQVYTADVSEIPKCNCKPADERPCGFESE
CLNRMLQYECHPQVCPSGERCCNQDFTKRLYPETKIIKTPGKGWGLISLRDVKKGEFVNE
YIGELIDEEECRARIKSAHENNITNFYMLTIDKDRIIDAGPKGNYSRFMNHSCQPNCETQ
KWTVNGDTRVGLFAVCDIPAGTELTFNYNLDCLGNEKTVCRCDAPNCSGFLGDRPKNSNG
QTAEPKAKRLKRKHKRKKSEGKKISEDDCFRCGDGGQLVLCDKKTCTKAYHLTCLNLTKR
PFGRWDCPWHHCDICGKNSEAFCHLCPNSFCKVHQEGVLRPWPPTGQLCCMEHEDPEGTA
HQAQVFSSEMKATAATTGTVTGRAKASRKPPATKGSKNKAAVV
NT seq 3912 nt NT seq  +upstreamnt  +downstreamnt
atggacggcattggtagctcattgcctttaatgcctgaaccagccaatccagtcagcatg
aagcagccacctgagtctttatgtgtgagaaaaggccacggggacatgggcagtgatcca
actctgctaatggacaaagctgcagcacagctggctgccaccttacaggatagcgtcctt
cagaagatggctggccacagtcacaacaaccacaatcatgagaggctgaaaagtctgact
tccctggtgctaaacggtgaccaggatgtgctgcctaagctgtgtactccagatccaccc
atgctacaaggtgctgaagccccagatgccacccatcagagcaactgcacgcctctcagt
gagccggagttaaaggtgaccatcccccaggtagtcaagcagttatcatatgaaccatcc
tatgctaaagggaccagcctagtcacggcctctgaaggtgctttatctggacacgatgaa
agaccggatgtgatgaacagaagagggagagcacacaaacccaaagctctactaaactgc
agttcatctgtgattgccatggattctctagaccacacagatactgttgatgacactaga
gcagctgatgagcatgcgctcatgttggaactggtggagcagtcaaaagaagagtctcct
ctgcaggctagtttttctgtcggggatctgatttgggcaaaagtgtcgggatacccttgg
tggccgtgcatggtgaccacagacccagagttcagcgttcatattaagcaaaaacagaag
gaaaccaatggcagattagggcccttttaccatatacagtattttggagatgccccagag
agaggctacatctttgagaagaacatggtgtcctttaccggagagaaccagtaccttgag
ctgagccaaagcagcaaagcagcagcttcctgttcagttcgtagaaagcgaactccctcc
ataccacgtaaactccaggctcagtggaacatgggcatcatccaggccaacgaggccctt
agcatgactcctgagaagcgcattgagaactttgtttttttttatgatgatgatgggcct
catctgaaccctcgcatcttggagaagctgaagccagatcagagtaacgtgatgatgcta
gagtccgagcacagtccagatcttctgtccctgctgaagttcacaacatcggcaccatgt
gtgaaagctgaaccagctgtacctcagaagaaagacgggtccaaagatgttcagcctcct
accaagtcaggaaggaggacaaaactatctccagtcaacagaactcatgacccaatgaga
aaaaccaaaatgaagctggtttcttttagaggaatgggttctaaaggagcctcgcttcaa
gctccagtaagaagagagcgaaagaagctaactgacgatgcgacgaacgaggatcaacaa
cccaataggagatgtaaaactagcaaaaacacagaaaaacaggtgtcaggtttagaagac
acaaacgacaagaagaggagaaagaagaaaaatgatcttaaagaaggaaaagaacccaga
aaacagacggtgaagtctaaaggtctccttaacgatgagcttaatgcagacaaaccgaag
cgtcacaggaaaaggaaacaagatggagagaaccagaacactgcctctaaagctaaaagg
aggcggtcctccccctgtcccaaccctgagggttctgggagtgaagaacgtccggattct
ccgagtgacagcctagatgggataaagaagagcgaacggaagaaagagtttgtctgtcag
atgtgtgagaaagccggtgaggacatggtgtcgtgtgaaggccagtgctgtgggatgttt
cacctccactgtttgggtctgtctctcaaacctgatgacaagctcctctgcccagagtgc
agctcaggagcacattcatgtttcatctgcaaacagctggagggtgaggttcgtcgctgc
cacgtccctcactgtgggaagttttaccacgagtcctgtgtccgcctcaaccccctcacc
atgtttgacaataagggcttccgctgtccactccacgcctgcctcagctgccactacggc
tcccagaccaggcccaagtctaccaagggccggttgatgcgttgccttaggtgccctgta
gcgtaccatgtgggtgatctgtgtgtagctgctgggagtgagatgatcacaaacacagct
atcatctgcaccaaccactttaatgccaagaagagctacagtcaccacagccacgtcaac
gtcagctggtgcttcgtctgctccaaaggaggacagctgttgtgctgcgagtcttgtcct
gcagcctttcaccctgactgcctgaacatcgctatgcctgatgggagctggttttgtaac
gactgccaagctgggaagaagccaaagtatagagacatcatatgggttaaactggggaca
tatcgatggtggccagcggagatccaccaccctaaaaacattcccactaatatccagcac
ctccgacatgagatcggagagttcccggtcttcttctttggctctaaggattacttctgg
actcaccagggaagagtctttccctacatggaaggtgaccggggcagcaaaaaccggaga
aagggaattggcaaagtcttcaagaatgctctgttggaggccgaggctcggtttaaagaa
gtgaagatgaaacgagaagccaaggaagctcaagagatcagccgaaaaccacctccttac
aaatttatcaaggtgaacaggcctttcggcagggtgcaggtctacaccgcagatgtgtct
gagattcctaagtgtaactgcaaaccggcggatgagcggccatgtgggtttgagtctgag
tgtctgaaccgcatgctgcagtacgaatgccaccctcaggtgtgtcccagcggggagcgc
tgctgtaaccaggacttcactaagcgcctctacccagaaaccaagatcattaagactcct
gggaagggctggggtctcatctccctgagggacgttaagaagggagagtttgtgaacgag
tacattggagagctgatcgacgaggaagagtgcagagcaagaatcaagtctgctcatgaa
aacaacatcaccaacttctacatgctcaccattgataaggaccgaatcattgacgccggt
cccaaaggaaactactcccgcttcatgaaccacagctgtcagcccaactgtgagacgcag
aagtggacggtgaacggagacactcgagttggcttgtttgcagtctgtgacataccagcg
ggaaccgagctcacctttaactacaacctggactgtcttggtaacgagaagaccgtctgt
cgctgcgacgctcccaactgcagcggtttccttggagatcgaccgaagaactcaaacggt
caaacagcggagccaaaggcaaagaggttaaagaggaagcataagaggaagaaaagtgaa
gggaagaagatatctgaggacgattgtttccgctgtggagatggaggacagctggtgctc
tgtgacaagaagacgtgcaccaaagcctatcacctgacctgcctgaacctcaccaaaaga
ccttttggccgctgggactgcccctggcaccactgtgacatctgtgggaaaaactccgag
gcattctgccatctctgcccaaactccttctgtaaggtgcaccaggagggggtcctgcgt
ccctggccccccacagggcagctgtgctgtatggagcatgaggatccggagggaactgcc
caccaggcccaggtctttagctctgagatgaaggccacagctgccacgacaggtaccgtc
accggccgcgccaaagcctccaggaaaccaccggcaaccaaaggctccaagaataaagcc
gctgtggtctga

DBGET integrated database retrieval system