KEGG   Nothobranchius furzeri (turquoise killifish): 107392885Help
Entry
107392885         CDS       T05163                                 

Gene name
ptgs2
Definition
(RefSeq) prostaglandin G/H synthase 2
  KO
K11987  prostaglandin-endoperoxide synthase 2 [EC:1.14.99.1]
Organism
nfu  Nothobranchius furzeri (turquoise killifish)
Pathway
nfu00590  Arachidonic acid metabolism
nfu01100  Metabolic pathways
nfu04370  VEGF signaling pathway
nfu04625  C-type lectin receptor signaling pathway
Brite
KEGG Orthology (KO) [BR:nfu00001]
 09100 Metabolism
  09103 Lipid metabolism
   00590 Arachidonic acid metabolism
    107392885 (ptgs2)
 09130 Environmental Information Processing
  09132 Signal transduction
   04370 VEGF signaling pathway
    107392885 (ptgs2)
 09150 Organismal Systems
  09151 Immune system
   04625 C-type lectin receptor signaling pathway
    107392885 (ptgs2)
Enzymes [BR:nfu01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.99  Miscellaneous
    1.14.99.1  prostaglandin-endoperoxide synthase
     107392885 (ptgs2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: An_peroxidase EGF
Motif
Other DBs
NCBI-GeneID: 107392885
NCBI-ProteinID: XP_015826435
LinkDB All DBs
Position
sgr17
AA seq 614 aa AA seqDB search
MRRSFWSMNRLTFALSLLALCFVCEGGNPCCSEPCQNRGVCTAMGADRYECDCTRTGYYG
QNCTTPEFLTRIKVSLKPSPNTVHHILTHFKAFWNIINSISFLRDAIMRYVLTSRSHMID
SPPTYNAHYGYKSWEAYSNLSYYTRALPPVPQDCPTPMGVVGKKELPDVKVLAEKLLVRR
KFIPDPQGTSLMFAFFAQHFTHQFFKSDMKNGPAFTVSKGHGVDLSHVYGVDLEKQHKLR
LFKDGKLKYQVINGEVYPPTVKDVGVEMHYPPHVPDSQRLAVGHEAFGLVPGLMMYATIW
LREHNRVCDVLKEVHPDWDDERLFQTSRLILIGETIKIVIEDYVQHLSGYHFKLKFDPEL
LFNQRFQYQNRIASEFNMLYHWHPLMPDSFQVEKRDYSYKEFIFNTSVMTEHGISSLVES
FTNQIAGRVAGGRNVPGPILYVAMKSIEQSRQMRYQSLNAYRKRFSMKPYSSFEDLTGEK
EMAALLEEMYGDVDAVELYPGLLVEKPRPNAIFGETMVEMGAPFSLKGLMGNPICSPEYW
KPSTFGGSVGFDIVNSASLQKLVCNNVQGPCPVASFHVPDIKETGPTVINSSTSHAQASD
INPTIILKERTSEL
NT seq 1845 nt NT seq  +upstreamnt  +downstreamnt
atgcgccggagcttttggagtatgaacagactcacatttgcgttgtccctgttggctctg
tgctttgtctgcgaaggaggtaacccctgctgctcagagccatgccagaacagaggtgtg
tgcacagcaatgggagcagacagatatgaatgtgactgcacacgtactggatattatggc
caaaactgcacaacgcctgaattcctcaccaggataaaagtctccctgaagccatcgcct
aacaccgttcaccacattctcacccacttcaaggctttctggaacatcatcaacagcatt
tcctttctcagagatgccatcatgagatatgtgctgacgtctcgatcccacatgattgac
agccctcccacttacaatgctcattatggttataaaagttgggaagcctactccaacctg
tcctactacacacgtgccctcccacctgtgccgcaggattgcccaacccctatgggagtc
gtaggtaaaaaagagctgccggatgtgaaggttttagctgagaagctcctggtgaggaga
aagttcattccagacccacagggtaccagcttgatgtttgccttctttgcacaacacttc
acgcaccagttctttaaatctgatatgaagaacggaccggctttcaccgtgtctaaaggt
cacggggtggacctgagtcacgtctacggtgttgacctggagaagcagcacaagctcagg
ctcttcaaggacggcaagcttaaatatcaggtaataaacggagaggtgtaccctccaaca
gtcaaggatgtgggtgttgaaatgcactacccccctcatgtcccagactctcagcgcctg
gccgtcggccatgaggccttcggtctggtccctggactcatgatgtacgccaccatctgg
ctccgtgaacacaaccgggtttgtgacgtcctgaaggaagtccacccagactgggatgac
gaaagactcttccagacctcccgactcatccttattggtgagaccattaagattgtgatt
gaggactacgtgcagcacctgagtgggtaccacttcaaactcaagtttgacccagagctg
ctctttaaccagcgcttccagtaccaaaaccgcatcgcatctgaattcaacatgctatac
cactggcacccactgatgccggacagcttccaggtggagaagagagattacagctacaaa
gagtttatctttaacacctctgtgatgactgagcacggcatcagcagcctggtggagtca
ttcaccaatcagattgcaggacgggttgctggtggccgtaatgtgccgggacccatcctg
tatgtggccatgaagtccattgagcaaagcaggcagatgcgttaccagtccctcaacgcc
tacaggaagcgattctccatgaagccttacagctcctttgaagacctgacaggcgaaaaa
gaaatggctgccttgctggaggagatgtacggtgatgtagatgccgtggagctctaccct
ggtctgctggtggagaaaccccgacccaacgccatcttcggggagacgatggtggagatg
ggcgctcctttctcactcaaaggcctgatggggaatcccatctgctccccggagtactgg
aagcccagcacctttggaggcagcgtgggcttcgacatcgtcaacagcgcctccctgcag
aagctcgtctgcaacaatgtgcagggcccctgtcccgtggcgtccttccatgtgcccgac
attaaagaaaccgggcccacggtcatcaactcaagcacatcccacgcccaagccagtgac
atcaaccccaccatcatcctgaaagagaggacatccgagctctaa

DBGET integrated database retrieval system