KEGG   Nothobranchius furzeri (turquoise killifish): 107393382
Entry
107393382         CDS       T05163                                 

Gene name
pdgfra
Definition
(RefSeq) platelet-derived growth factor receptor alpha
  KO
K04363  platelet-derived growth factor receptor alpha [EC:2.7.10.1]
Organism
nfu  Nothobranchius furzeri (turquoise killifish)
Pathway
nfu04010  MAPK signaling pathway
nfu04020  Calcium signaling pathway
nfu04144  Endocytosis
nfu04510  Focal adhesion
nfu04540  Gap junction
nfu04810  Regulation of actin cytoskeleton
Brite
KEGG Orthology (KO) [BR:nfu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    107393382 (pdgfra)
   04020 Calcium signaling pathway
    107393382 (pdgfra)
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    107393382 (pdgfra)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    107393382 (pdgfra)
   04540 Gap junction
    107393382 (pdgfra)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    107393382 (pdgfra)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:nfu01001]
    107393382 (pdgfra)
  09183 Protein families: signaling and cellular processes
   04090 CD molecules [BR:nfu04090]
    107393382 (pdgfra)
Enzymes [BR:nfu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.10  Protein-tyrosine kinases
    2.7.10.1  receptor protein-tyrosine kinase
     107393382 (pdgfra)
Protein kinases [BR:nfu01001]
 Receptor tyrosine kinases (RTK)
  PDGFR family [OT]
   107393382 (pdgfra)
CD molecules [BR:nfu04090]
 Proteins
  107393382 (pdgfra)
SSDB
Motif
Pfam: PK_Tyr_Ser-Thr Pkinase Ig_3 I-set ig Ig_2 V-set C2-set_2 Herpes_gE Izumo-Ig
Other DBs
NCBI-GeneID: 107393382
NCBI-ProteinID: XP_015827169
UniProt: A0A1A7Z914
LinkDB
Position
sgr17
AA seq 1464 aa
MDGMKTYFFGLIFVVVVSVTPGLSTPTIWPNQDELFLQPSSPINISCTGDRDVAWLEPLP
EDAVVISEGFSSTLLIPKATVEHTRFYECTYVNQIDIEEEHEEMAYIYIFVQDPHIPFVP
ETPENLIIPHDSFRVIIPCRASHPTASVILRSVPAREKISNSYDYKTGFIDNLPPGQYQC
ETTVNGQTFASDVYTVKTEELEKVEDFEVEVKASEETLRAGQPLNITCIAPSGSGFQQQW
VHSKKQAVNANQMKQTAPDWVIYSLSIPRAAAQDSGVYECSVTHTVSGRTRVSRVAVTVF
EENSFLALDHSGILTTEFVSILEETQFTILINAYPAPSVSWLKDGTALSENYYISSNLSR
IEGNRYESTLTFRHPLEKNSGNYTIRAWSDSHTAQFSFLLKVRASAGLMILPSSAPVLLP
NVDEMVAPLHTAFVLTCRGAAHLEWEIPHTVLEQTQQDSSGLYVTSITVEKATAMHTGYY
ICFYTNATHHTEESSIYVYVPDPDAPFVPSPWPFMNPVLSDHEEMEIPCRVSDPTAHVTL
LNVDTQQPVPCVYDSKRGALGIFTAGTYVCKALIKGKEHYSEEYIVHGLIGTLHVELSAK
KTALMVGDTIVVNCLARGPEMLEDHWKYPGKLANRGSKTVKENRKAQEILYTLTIPQAST
KDSGVYSCSLTDIVSTKSQTKEVNIQVFASEVMSIQPEFREYESAELDEVREFKVKIDSF
PEARITWLKDGSPLSNVTAEISTNLRQISEISYISALTLIRAKEDDSGNYTMRVQNGNQS
QEASFILEVKVPAVIVDLMDLHHGSATGQSVVCITRGQPTPVVEWFICKNIKHCANDTSS
WVPLLSNATEITMESHLDEESNLESQVMFGHLESTLAVRCLARNEMAAVSREVKLVSNGP
HPELTVAAAVLVLLVIVIISLIVLVVIWKQKPRYEIRWRVIESVSPDGHEYIYVDPMQLP
YDSRWEFPRDRLVLGRILGSGAFGKVVEGTAYGLSRSQPVMKVAVKMLKPTARSSEKQAL
MSELKIMTHLGPHLNIVNLLGACTKSGPIYIITEYCFYGDLVNYLHKNRENFLSLSPEKN
KKELDIFGINPADENSRSYVILSFEGKADYMDMKQVDNTQYVPMLEISSTSKYSDIRRSN
YDHPPPQKGSNEAEMDNLLSDDMNEGLSTTDLLSFTYQVAKGMEFLASKNCVHRDLAARN
VLLSQGKIVKICDFGLARDIMHDNNYVSKGSTFLPVKWMAPESIFDNLYTTLSDVWSYGI
LLWEIFSLGGTPYPGMVVDSSFYNKIKSGYRMSKPEHAPDDVYEMMMKCWNSEPDKRPSF
MGLSESVASLLPSSYKKHYEKVNHDFLKSDHPAVTRVCVETDADYVDIPYKNQGKLKDRE
SGFDEQRLSSDSGYIIPLPDLDPVSDEEYGKRNRHSSQTSEESAIETGSSSSTYAKREGE
TLEDITLLDEMCLDCSDLVEDSFL
NT seq 4395 nt   +upstreamnt  +downstreamnt
atggatgggatgaagacgtacttctttgggctcatctttgtcgtggtggtttcagtcaca
cctggactgtccacaccgaccatctggccaaaccaggacgagttgttcctgcagcccagt
tctcccatcaacatcagctgcactggggacagagacgtggcttggctcgaacccctccct
gaagatgctgttgttatttcagagggtttctcttcaactctcttgattcccaaagcaact
gttgagcacacccgtttttatgagtgcacatacgtaaaccagattgacatagaagaagag
catgaggaaatggcgtacatctacatctttgtccaagatccccacatcccctttgtccca
gagacaccggaaaacctcatcattccccatgactcttttcgggtgatcatcccctgccgt
gcatcccacccgactgcttctgtcatcctgaggagcgtcccagccagagagaagatcagc
aactcctacgactacaaaacgggtttcatcgacaacctccctcctgggcagtaccagtgt
gagaccactgtgaacggccagacgttcgcgagtgacgtctacactgtaaaaaccgaggaa
cttgagaaggttgaggactttgaggtggaagtgaaagccagtgaagagacgttaagggct
ggccagcctctcaacatcacctgcatcgctccgtctggatcaggcttccagcagcagtgg
gttcactcgaaaaaacaggctgtaaatgcaaatcagatgaagcagacagcccctgactgg
gtgatctacagcctcagcatcccacgagccgccgctcaggacagcggcgtgtacgagtgc
tcggtcacacacacggtcagtggaagaaccagagtcagcagagtggctgtgactgttttt
gaagagaactcctttttggctctggaccacagcgggatcctcacgacggagtttgtcagc
attttggaggagacacagttcaccatcctgattaatgcctatccagccccttcagtgtca
tggctgaaagatggcacggcgctgtcagagaactactacatctcctctaatttaagccgc
attgaagggaaccggtatgagagcactctgaccttccggcaccctctggagaaaaacagc
gggaattacacgatcagagcttggagcgactctcacacagcccagttctccttcctcctc
aaagtgagagcttcagctggattgatgatcttaccatcctcagccccggtgctgctgcca
aatgtggatgagatggtagcgccccttcacaccgcttttgtcttgacgtgtcgcggggca
gcacatctggagtgggagataccgcacactgttctggagcagacgcagcaggacagcagc
ggcctgtatgtgacctccatcaccgtggaaaaagcaacggccatgcacaccggctactac
atctgcttctacacaaacgccacacaccacacagaggagagcagcatctacgtctacgtt
ccagatcctgatgccccctttgtgccatcaccttggcctttcatgaatcccgtcctgtcc
gaccacgaggagatggagattccctgcagagtgtctgacccaacagcacacgtgacactg
ctgaacgttgacacccagcagcctgtgccttgtgtttatgacagtaaaagaggggctttg
gggatatttactgctggaacctacgtctgcaaggccctcattaaaggaaaggagcactac
agtgaggagtacatcgttcacggcttgataggcacattgcacgttgaactgtcagccaaa
aagacagctctgatggttggggacaccatcgttgtcaactgtctggctcgaggacctgag
atgttagaagaccactggaagtacccaggcaagctggctaatcgcggcagcaaaaccgtt
aaagagaacaggaaggctcaggagatcctgtacactctgacaatcccacaagcttcaacc
aaagacagcggcgtctactcctgttcgctcactgatatagtctctactaagagccagacg
aaggaagtcaacatccaagtgtttgccagtgaggtcatgtccatccagccagagtttagg
gagtacgaatctgcagagctagacgaggtgcgggagttcaaggtgaagatcgactctttt
ccagaagctcgtatcacttggttgaaagacggtagccctctcagcaatgtgacagcggag
atctccaccaacctgaggcagatcagtgagatcagctacatcagtgctctcactctgatc
cgggccaaggaggacgacagtgggaactacaccatgcgggtgcagaacggaaaccaaagt
caagaagctagcttcatcctcgaggttaaagtgcctgcagtgatcgtagatctgatggac
ctccaccacggttcagccacaggccagtctgtggtttgcattaccagagggcagcccact
cctgtggtggagtggttcatctgcaagaacatcaaacattgtgccaatgacacatcgtcc
tgggtgcctctcctctccaatgccactgaaatcacgatggagtcgcacttggatgaagag
agcaacctggagagccaggtcatgtttggtcatctggaaagcacgctggcagtccgttgc
ctagcaagaaatgaaatggctgctgtcagcagggaagtcaagctggtgtccaacggccct
caccctgagctgacggtagctgctgccgtgctggtgctcctggtcattgtcatcatctca
ctcattgtcttggttgttatctggaaacagaaaccacggtatgagattcgctggagggtc
atagagtctgtgagcccggacggccatgagtacatctatgtggatcccatgcagcttccc
tacgactccagatgggagttcccccgtgacagactcgtgctcggtcggattctgggttct
ggagcttttgggaaggtggttgaaggcaccgcctatggacttagccgctcccagccagtt
atgaaggtggcagtgaaaatgctgaagcccacagctcgctccagtgagaagcaggctctg
atgtctgaactgaagatcatgactcatctcggacctcatctgaatatcgttaacctcctg
ggagcgtgcaccaagtcaggccctatctacattatcactgagtactgcttctatggagac
ctggtcaactaccttcacaagaacagggagaacttcctgagcctgagcccggagaaaaac
aagaaggaactggatatatttggaattaaccctgcagatgagaacagcaggagctatgtg
atcctgtcctttgagggtaaagcagactatatggacatgaagcaagtggacaacactcag
tatgttcccatgctggagataagtagcacctccaagtactccgacatccggaggtccaac
tatgaccatcctccccctcagaaaggttcaaacgaagctgagatggacaacctgctgtcg
gatgacatgaacgaaggcctctcaacaaccgacctgctcagctttacctaccaggtggcc
aaaggaatggagtttcttgcttccaaaaattgtgtacatcgagacctagcggccagaaat
gtcctcctctctcagggcaagatagttaaaatctgtgactttggactggccagagacatc
atgcatgacaacaactacgtctccaaaggaagcacatttttgccagtgaagtggatggct
ccggaaagtatttttgacaacctctacacaactctgagtgacgtttggtcatatggcatc
ctcctctgggagatattctctttaggtggtacaccgtatccaggaatggttgtggactcc
agcttctacaataagatcaagagcggttacaggatgtccaaaccagagcatgctccagat
gatgtctatgagatgatgatgaagtgctggaacagcgagcccgacaagaggccgtccttc
atgggtctgagtgaatctgtggcatctttgctgccctccagctacaagaagcattacgag
aaggtgaaccatgatttcctgaagagcgaccatccggctgtcactcgggtgtgcgtggag
actgatgccgactacgtggacattccatacaagaaccagggcaagctaaaagacagggag
agtggctttgatgagcagcggctgagctctgacagtggctacataatccccctccccgac
ctggacccagtgtctgatgaagaatacggaaagaggaacagacacagctctcaaacatct
gaggagagcgctatagagacagggtcgagcagctccacctatgctaagcgtgagggggag
accctggaggacatcacactgctggacgagatgtgcctggactgcagcgacctggtggag
gacagctttctgtga

DBGET integrated database retrieval system