KEGG   Nothobranchius furzeri (turquoise killifish): 107393400Help
Entry
107393400         CDS       T05163                                 

Gene name
tgm1
Definition
(RefSeq) protein-glutamine gamma-glutamyltransferase K isoform X1
  KO
K05619  transglutaminase 1 [EC:2.3.2.13]
Organism
nfu  Nothobranchius furzeri (turquoise killifish)
Brite
KEGG Orthology (KO) [BR:nfu00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    107393400 (tgm1)
Enzymes [BR:nfu01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.13  protein-glutamine gamma-glutamyltransferase
     107393400 (tgm1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Transglut_N Transglut_C Transglut_core PepSY_2
Motif
Other DBs
NCBI-GeneID: 107393400
NCBI-ProteinID: XP_015827210
LinkDB All DBs
Position
sgr17
AA seq 797 aa AA seqDB search
MFLCLFPVRMPAVTRSIRDRTTIGRFPTVTLGFGEDEVEEKEELEKEDDDSEESACRRWL
RKACPCCYRKPNDDGLTEMVVTGIDGPGHERETDGKPTTGGKDLDELVLKVKSIDLMKTK
SGDNHTEHHTDRYQSDRLIIRRGQTFQMWIVLSRPFDPHHDKLHLELKTGSLPAVSKGTH
VIVPLVESLEDGCWEAAVVKQDDNRIKLSVNSPPTAVIGRYQLTVETSCANSQATSPHDP
ANDIYMLFNPWCEEDSVFLDSEDERQEYVLNDVGRIYYGTEYQIGERAWNYGQFDVGILD
ACLFVLEKSGTPSSGWGDPVNMVRIISAMVNSPDDFGVLMGNWSGDYSKGTSPTVWSGSV
EILKEYQKNNGTPVKYGQCWVFAGVVTTVLRCLGIPARTVTNFSSAHDTDVSLTTDVYLD
ENLEPIEYLNADSIWNFHVWNDCWMARPDLPPGNGGWQAVDATPQETSQGIFRCGPASVA
AVRNGQVFLKHDCAFVFAEVNSDKIYWQKKADGTFSQIYSEKKIVGHSISTKAVGSDERN
DITNLYKYTEGSEEERIAVETACRYGSKAKAYSSPTAEDVSVEVILEGEGPKMGMDAELT
IKLKNVSSEKRKVSLLSQLAVMYYTGVYKATVKKDKMDVELLPSEETLLALVLEYNMYKN
QLIDHAALMLTVSGRVQETQQVLATQFSFRLRTPDLIIKPIGKAVVGEEMTVDISFTNPL
PQVLKKVIFCVEGLGLLPAKKTEHADIGSHASISFVEHFVPTLPGPRKLLASLDCKQLTQ
VHGVCDITVEDKSSTAP
NT seq 2394 nt NT seq  +upstreamnt  +downstreamnt
atgttcttgtgcttgtttcctgtcaggatgcctgcagtgacacgatcaataagagacaga
actactataggtcgattcccaacggtcactctgggatttggggaggatgaggtggaggaa
aaagaagaactagagaaagaagacgatgacagcgaagagagtgcctgccggcgatggctg
cgtaaggcgtgcccgtgctgttatcgtaagccaaacgatgatggcctcacagaaatggtg
gtcacagggatagatggtccgggacatgagagggagactgatgggaaacctacaacagga
gggaaggatctagatgaacttgtcctgaaggtcaaatcaatcgacttgatgaaaaccaaa
tcaggggacaaccacacagaacaccacacagatcgctaccaaagtgacagattgatcatc
cgcagagggcagacattccagatgtggatcgtcctgtctcgaccttttgaccctcaccat
gataagctccatctggaacttaaaacagggtcactgccagcagtgtcaaagggaactcat
gttattgtccctctggtggagtcgctggaggacggttgttgggaggctgctgtagtgaag
caggatgacaacaggataaagctgtctgtgaattcacctcccacggctgtcattggccga
tatcagctcactgtggagactagctgtgcaaacagccaggctacatccccccatgaccct
gcaaatgacatttacatgctattcaacccctggtgtgaagaggactctgtgtttctggat
tcggaggacgagaggcaggaatacgtcctcaatgacgttggaagaatctactacggtaca
gagtatcaaattggagagagggcttggaactatggacagtttgatgttggaattctcgat
gcttgcctctttgtgctggaaaagagtggaactcccagctctggttggggggacccagtt
aacatggtgcggatcatctcagccatggttaattctccagatgactttggtgtcctgatg
ggaaactggtctggagactactccaagggaacttctccaactgtttggagtggcagtgtg
gaaatcctgaaggagtaccagaaaaacaacggcaccccagtgaagtacggccagtgctgg
gtttttgctggtgttgttactacagttttacggtgtttaggtattcctgctcgaactgtg
accaacttcagctcagctcatgatactgacgtctccttgacaacagatgtgtacctggat
gagaacctggagcctatagagtaccttaatgcagactctatatggaacttccatgtgtgg
aacgattgctggatggctcgtccagacttgcctcctggaaacggaggctggcaggcagtc
gatgcgacaccacaggaaaccagccagggcatcttccgctgtggtcctgcttcagttgct
gctgttcgtaatggtcaggtcttcctcaaacatgactgtgcctttgtgtttgctgaggtg
aacagtgataaaatctactggcagaagaaagcagatggtaccttcagtcaaatctacagt
gagaagaagattgtaggtcactccatcagcactaaggcagtaggatcagatgaacgcaat
gacatcacaaacctctacaaatatacggaagggtcagaggaggagcgcatcgccgtagaa
acggcctgccgctacggctcaaaggccaaagcctattcatccccaacagctgaggacgtt
tctgtagaagtgatcctggaaggagagggtccaaaaatgggaatggatgcagagctgacc
atcaagttgaagaacgtcagctcagagaagcgtaaagtctcactgctcagccagctagca
gtcatgtactacaccggagtctacaaagccacggtcaaaaaggacaaaatggatgtggag
ctgttgcccagtgaagagacattgttggcattggtcctggagtacaacatgtacaagaac
cagctgatagaccatgctgccctcatgctgactgtgtcaggaagggttcaggaaacacag
caggtcctagccactcagtttagtttccgactcagaaccccagacctcatcataaagcca
ataggaaaggctgttgtgggggaggagatgacagtggacatttccttcaccaaccctcta
cctcaggtgctgaaaaaagtcatattttgtgtggaaggacttggtcttctacctgcaaaa
aagactgaacacgcagatattggcagccatgcctccatctccttcgtggagcactttgtc
cccactcttcccggaccaaggaaattactggcttctctagactgcaagcagctcacacag
gttcatggagtgtgcgacattacagtggaggacaaaagcagcaccgctccatag

DBGET integrated database retrieval system