KEGG   Nothobranchius furzeri (turquoise killifish): 107393554Help
Entry
107393554         CDS       T05163                                 

Gene name
galnt9
Definition
(RefSeq) polypeptide N-acetylgalactosaminyltransferase 9 isoform X1
  KO
K00710  polypeptide N-acetylgalactosaminyltransferase [EC:2.4.1.41]
Organism
nfu  Nothobranchius furzeri (turquoise killifish)
Pathway
nfu00512  Mucin type O-glycan biosynthesis
nfu01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:nfu00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00512 Mucin type O-glycan biosynthesis
    107393554 (galnt9)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01003 Glycosyltransferases [BR:nfu01003]
    107393554 (galnt9)
Enzymes [BR:nfu01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.41  polypeptide N-acetylgalactosaminyltransferase
     107393554 (galnt9)
Glycosyltransferases [BR:nfu01003]
 O-Glycan biosynthesis
  Mucin-type
   107393554 (galnt9)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glycos_transf_2 Ricin_B_lectin Glyco_tranf_2_3 Glyco_transf_7C
Motif
Other DBs
NCBI-GeneID: 107393554
NCBI-ProteinID: XP_015827486
UniProt: A0A1A8U7H5
LinkDB All DBs
Position
sgr18
AA seq 604 aa AA seqDB search
MAVARKIKTLLTVNILVFVGIILFSVYCRIQDRSEELIQIGRISDQRLRARNGKVSNLVD
RQSILQRLERLEDVVYNQLNGLAKPMGLVEGPGGLGQGGAAATLGEDSHDSEGKYEEYGY
NAQLSDRISLDRSIPDYRPKKCKQLTYPEDLPQISVVFIFVNEALSVILRSVHSVVNHTP
AHLLKEIILVDDNSDSVELKFNLDQYVNKRYPGLVKIVRNSKREGLIRARIHGWNAATAP
VVGFFDAHVEFNTGWAEPILTRMKEDHTRIILPAIDNIKYNTFEVQQYANAAHGYNWGLW
CMYIIPPQEWLDKGDETAPIRTPAMIGCSFVVDREYFGEIGLLDPGMEVYGGENIELGMR
VWQCGGSMEVLPCARVAHIERTKKPYNNDIDYYAKRNALRAAEVWMDEYKSHVYMAWNIP
MNNPGVDFGDVSERLALRKRMQCQSFRWYLEHVYPEMRIYNNTITYGEVRNSKASGYCLD
QGSEDDDKAILYPCHGMSSQLARYSTEGLLQLGPLGSTTFLPDTKCLIDDGRGRTPSLKK
CDVVSRISQRLWDFTQNGPIINRDTGRCLEVEMSKDANFGLRLVVQRCSGQKWMIRNWIK
HPRH
NT seq 1815 nt NT seq  +upstreamnt  +downstreamnt
atggctgtggcacgcaaaattaaaactttgctgacggtcaacattttggtgttcgtgggg
attatcctgttctcagtctactgcaggatccaggaccgatccgaggagctcatccagatt
gggcgcatttctgatcagaggctcagagccagaaatggaaaagtttccaacttggtggac
aggcagtccattcttcagcgtctggagagactggaggatgtggtgtacaaccagttaaac
ggtttagcaaagcccatgggcctggtggagggacctggaggtcttggccaagggggagct
gctgccactcttggagaagacagccacgattcagaggggaagtatgaggagtacggctac
aacgctcagctcagtgatcgcatctccctggacaggagcatcccagattacaggcctaag
aagtgtaagcagctgacttacccagaggaccttcctcagatctctgtggtcttcattttt
gtgaatgaggcgctatcagtgatcctccgctccgtccacagcgtggtcaatcacacacct
gcacatctgctcaaggaaatcatccttgtggatgataacagtgacagcgtggagctgaaa
ttcaacctggatcagtacgtgaacaaacgctaccctggcttggtgaagattgtgagaaac
agcaagcgggagggcctgatccgtgccagaatccatggctggaacgcggccacggctccc
gtcgtcggcttctttgatgctcatgtggagttcaacactggctgggctgaacccattctg
acccgaatgaaagaagatcacacccgcatcatccttcctgccatagacaacatcaagtac
aacacctttgaggtgcagcagtatgccaacgccgcccacggctacaactggggcttgtgg
tgcatgtacatcatccctccacaggagtggctggacaagggcgatgagacagcccccatc
agaactccagcgatgattggctgctcctttgtggttgatcgggaatactttggtgagatc
ggcctgctggatccaggtatggaggtgtacggaggagaaaacatcgagctgggcatgcgg
gtgtggcagtgtggcgggagcatggaggtcctgccgtgtgcccgagtagcccacattgag
cgcaccaagaaaccatacaacaacgacattgactactatgccaaacgcaatgccctgaga
gcggctgaggtgtggatggatgagtacaaatcccacgtctacatggcctggaacatcccc
atgaacaacccaggtgttgatttcggggacgtgtcggagcgcttggccttaaggaaacgg
atgcagtgtcaaagctttcgctggtaccttgagcacgtttacccagagatgaggatctac
aacaacaccatcacatacggcgaggtgagaaacagcaaggccagtggctactgtctggac
caaggctctgaggacgatgacaaagccatcctctacccctgccacggcatgtcctcacag
cttgcccgctactcgacagagggccttctgcagcttggacctctggggtcgaccaccttc
ctgcctgacacaaaatgcctcattgatgacggaagaggacggactcccagtctgaagaaa
tgtgatgtcgtctccaggatttcacaaaggctttgggacttcacacagaatggtccaatc
attaacagagacactggtcggtgtctggaagtggaaatgtccaaagatgctaactttggt
ctgcgcctggtggtccagagatgctcgggccagaagtggatgatacgaaactggattaaa
catcccagacactga

DBGET integrated database retrieval system