KEGG   Nothobranchius furzeri (turquoise killifish): 107394301Help
Entry
107394301         CDS       T05163                                 

Definition
(RefSeq) proepiregulin-like
  KO
K09784  epiregulin
Organism
nfu  Nothobranchius furzeri (turquoise killifish)
Pathway
nfu04010  MAPK signaling pathway
nfu04012  ErbB signaling pathway
Brite
KEGG Orthology (KO) [BR:nfu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    107394301
   04012 ErbB signaling pathway
    107394301
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: EGF Cys_rich_VLP
Motif
Other DBs
NCBI-GeneID: 107394301
NCBI-ProteinID: XP_015828680
LinkDB All DBs
Position
sgr18
AA seq 154 aa AA seqDB search
MWNIRTSALLPLLGVVLIWPNVFTESVSHNLITSDSSSVSQAEGEERPRVTKRSFESCDS
TFDHYCLNNGKCMLLLDMNEHHCKCGTEFSGSRCEHLNFVVQPLAEGQIIFIVFCVILLT
LGLSGALYLCCKWYKQSKFSQQQKQPSYKVVQAV
NT seq 465 nt NT seq  +upstreamnt  +downstreamnt
atgtggaacatcagaacctcagccctgctcccgctgctcggtgttgtgctgatttggcca
aatgtgtttaccgagagtgtttcccacaacctgatcacgtcagacagctcgtccgtgtct
caagctgagggagaagagcgcccccgtgtgacgaagcggtcctttgagagctgcgacagc
acgtttgaccactactgtctgaacaacggcaagtgtatgctgctgttggacatgaacgaa
caccactgcaagtgtgggactgagttctctgggtccaggtgtgaacatctgaattttgtt
gttcaacctttggctgaaggacagatcatcttcatcgttttctgcgtgattctgctgacg
ctcggcctgtctggagctctgtacctctgctgcaagtggtacaaacagagcaaattctca
cagcagcagaagcagccgagttacaaagtcgtccaggcggtttga

DBGET integrated database retrieval system