KEGG   Nothobranchius furzeri (turquoise killifish): 107394433
Entry
107394433         CDS       T05163                                 

Gene name
atf6b
Definition
(RefSeq) cyclic AMP-dependent transcription factor ATF-6 beta isoform X1
  KO
K09049  cyclic AMP-dependent transcription factor ATF-6 beta
Organism
nfu  Nothobranchius furzeri (turquoise killifish)
Pathway
nfu04141  Protein processing in endoplasmic reticulum
nfu04261  Adrenergic signaling in cardiomyocytes
Brite
KEGG Orthology (KO) [BR:nfu00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    107394433 (atf6b)
 09150 Organismal Systems
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    107394433 (atf6b)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:nfu03000]
    107394433 (atf6b)
Transcription factors [BR:nfu03000]
 Eukaryotic type
  Basic leucine zipper (bZIP)
   CREB
    107394433 (atf6b)
SSDB
Motif
Pfam: bZIP_1 bZIP_2 bZIP_Maf YabA DUF4407
Other DBs
NCBI-GeneID: 107394433
NCBI-ProteinID: XP_015828851
UniProt: A0A1A8VDB0
LinkDB
Position
sgr19
AA seq 703 aa
MATDLLSDLDTRFFADNLLTSEDWDACLYQCESMEEGEDGDFGGGLKYDATLDNDLVLTL
DPDNRTSPWRHLDDNLLTGNASVMKSEMTITEPLPVEMLFQVKAEPPSPASSLDSDCSGL
SDLQVTVKGENPPTPPYMYGDVLSPPLETTEVTVATTAVPPVQNLIPTVIQSQLQTSVPA
VIQTQATVLTSSTTKKASSILSTKPPIQPRPVCVATLPITQNPTPAKTLILQSLPPMDQT
RPVVLSPSVCLSSAPAIVKMEPVSPSVPQHCSTPTSKPIVPATTPLPGNNSNDIDMKVLK
RQQRMIKNRESACQSRKKKKEYLQNLEALLREAQQENERLRRENQALRERLTGKESGDSA
SNKRAVCVMAVLLFMTFSFGPVSITDRKLSVGLQEDVVPFSGRRLLEVKQQQVLDEPLSK
AEDKTEEDGGDERWKREDVERYSPESLQFRNLSDLFSDVKDLALQGIDRYFTSSDCRQFN
RSESLRLADELRGWVHRHQIDRKKSGGKAKVAKKAKVTQQKAQLRKANISRYLPIQSHRS
IESQLKVFPGPEVTYSDFLDAIDRREDTFYVVSFRRDHLLLPAISHNKTSRPKMSLVMPA
MAVNESLYNSSQGYEIMMQVDCEVMDTRIVAIKSSAVPPSLRDPTPPPPSSQHNGHHHHI
NNTSLRGRHQQHHSSSPASSSSPSPRRQPLPAPEYLISQAQDV
NT seq 2112 nt   +upstreamnt  +downstreamnt
atggctacggatttactatcagatctggacactcgattcttcgctgataacctcttgacg
agcgaagactgggatgcctgcttgtaccagtgtgagagcatggaggaaggagaggacgga
gacttcggcggtgggctgaaatacgatgcaacgttggacaatgacctcgtgctcaccctc
gatcctgacaaccgcacgtcgccatggcgacaccttgacgacaaccttctcacaggaaac
gcttcagtgatgaaaagtgagatgacgataacggagccgttaccggtggagatgttgttc
caggtgaaagcagaacccccctctcctgcttcatcgttagactccgactgttccggctta
tcggacctacaggttacagtcaaaggcgaaaaccctccgactcctccctacatgtacgga
gacgtactgtctcctcccctggagacaacggaggtaaccgtggcaacgacggccgtaccc
ccagtgcagaacctgatacctacagtcatacagtcccagctgcaaacatctgtcccagct
gtcatccagacacaagctacagttttgaccagttctacaacgaagaaggccagcagcatc
ctgagcaccaaacctcccatccagccccggcccgtttgcgtcgccaccctccccatcacc
cagaaccccacaccagccaagaccctcatcctgcagagcctccctcccatggaccagacc
cggcccgtcgtcctctctccatccgtctgcctcagctcagcccccgccatcgttaaaatg
gagcccgtctctcccagcgtcccccagcactgctccacccccaccagcaaacccatcgtc
ccggcaaccacgccgttgcccggcaacaactccaacgacattgatatgaaggtgctgaag
cggcagcagaggatgatcaaaaaccgagagtccgcctgccagtccaggaagaagaagaag
gagtacctgcagaacctggaggctctgctgagggaggcccagcaggagaacgagagactc
cggagggagaaccaggcgctccgggagaggctgactgggaaggagagcggcgactcggcg
agcaacaagagagccgtgtgtgtcatggccgtcctgctgttcatgaccttcagcttcgga
cccgtcagcatcacggacaggaagctgtcggtgggtctgcaggaagacgtggtgccgttc
tctggtcggcgtctgctggaggtcaaacagcagcaggtgttggatgagcctctcagcaaa
gcggaggacaagacggaggaggatggaggagacgagcgatggaagagagaagatgtggag
agatactctccagagtctctccagttcaggaacctgagtgatctgttcagcgacgtgaag
gacctggctctgcagggcatcgatcgttatttcacctcttcagactgcagacagttcaac
cgctccgagtcgctcaggctcgctgatgagctgagaggttgggttcatcgacatcagatc
gaccggaagaagtctggaggaaaagcaaaggtcgccaagaaggcaaaggtcacgcagcag
aaagctcaactgaggaaggcaaacatctccagatatctgcccatccagtctcatcgctcc
atcgagagtcagctgaaggtctttcctggtcctgaggtcacctacagcgacttcctggat
gccatcgaccgccgagaggacaccttctacgtcgtctccttcaggcgggaccacctgctg
cttcctgctatcagccacaacaaaaccagccggcccaagatgtctctggtgatgcctgcc
atggccgttaacgagagtctgtacaactcgtctcagggctatgagataatgatgcaggtc
gactgcgaggtcatggacacccgaatcgtcgccatcaagtcgtccgccgtccctccatct
ctacgtgacccgactccacctcccccctcctcccagcacaacggccaccatcaccacatc
aacaacacctccctccgaggacgccaccagcaacaccactcctcctcaccggcctcctcg
tcatcaccatcccctcgacggcagccattacccgccccggagtacctgatcagtcaggct
caagatgtctga

DBGET integrated database retrieval system