KEGG   Nothobranchius furzeri (turquoise killifish): 107397221
Entry
107397221         CDS       T05163                                 

Definition
(RefSeq) uncharacterized protein LOC107397221 isoform X1
  KO
K05461  KIT ligand
Organism
nfu  Nothobranchius furzeri (turquoise killifish)
Pathway
nfu04010  MAPK signaling pathway
nfu04916  Melanogenesis
Brite
KEGG Orthology (KO) [BR:nfu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    107397221
 09150 Organismal Systems
  09152 Endocrine system
   04916 Melanogenesis
    107397221
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:nfu04052]
    107397221
Cytokines and growth factors [BR:nfu04052]
 Growth factors
  Growth factors (RTK binding)
   107397221
SSDB
Motif
Pfam: SCF
Other DBs
NCBI-GeneID: 107397221
NCBI-ProteinID: XP_015832635
LinkDB
Position
Unknown
AA seq 288 aa
MKKSKSWIHVCVRFLLFITFGVHSATLKVTVTDDTDTIIPSLRQNIPNDYKIPVTYITKE
VGGMCWANLNVYNVEQSLQELANKFGNISTNKHDIKILIIYFYEERLDIKVNLEALMVDF
QCHYRTEKWETQRYFDFVKELYNALKHENSSNECEEPPCPTTVPLDSPTLSESPTPSESP
TLSESPIHNNTDSKCTTSYPSRACSHISNPTSEEPLDMMKLILLSSLFVSVLTIILMCVV
WKVRSPSNRQAHQQSPVEDDSFTGSEGTEPPGSAETQEKIMLNVIETV
NT seq 867 nt   +upstreamnt  +downstreamnt
atgaagaagtcaaaaagttggatacacgtctgtgtccgtttcctgctgttcatcacgttt
ggggttcattcagctacacttaaagttactgtgactgatgacacagacacaataatccct
tcactgagacagaatattccaaacgactacaaaattcctgtaacctacattacaaaagaa
gtgggtgggatgtgttgggcaaatttaaatgtttacaacgtggagcagagtttacaagaa
ttagccaataagtttggaaacatttcaaccaataaacacgatattaaaatactcattatc
tatttttacgaagagcggctagatatcaaagtgaacctggaggcgctaatggtggatttt
cagtgccactacaggacagaaaaatgggaaacacagcgatactttgactttgttaaagaa
ctctacaatgctttaaagcatgaaaactcttctaatgagtgtgaagaacctccctgtccc
acaacagttcccttggactcacccactctctcagagtcacccactccctccgagtcaccc
actctctcagagtcacccattcacaacaatacagattcaaagtgtacgacgagctacccg
tcacgtgcctgttcacatatcagtaatccaacatcagaagagcctctggacatgatgaag
ctgatcctcctctcctcactgtttgtttcagtcctcacaatcatcctgatgtgtgtggtg
tggaaggtcagatcgccaagtaacagacaggctcatcaacagagtcccgtagaagatgat
tcctttaccggatcagaagggacagaacctccaggaagcgctgaaacacaggaaaaaatt
atgttgaacgtcattgaaacggtgtaa

DBGET integrated database retrieval system