KEGG   Nothobranchius furzeri (turquoise killifish): 107397320Help
Entry
107397320         CDS       T05163                                 

Gene name
dot1l
Definition
(RefSeq) histone-lysine N-methyltransferase, H3 lysine-79 specific isoform X1
  KO
K11427  histone-lysine N-methyltransferase, H3 lysine-79 specific [EC:2.1.1.43]
Organism
nfu  Nothobranchius furzeri (turquoise killifish)
Pathway
nfu00310  Lysine degradation
Brite
KEGG Orthology (KO) [BR:nfu00001]
 Metabolism
  Amino acid metabolism
   00310 Lysine degradation
    107397320 (dot1l)
Enzymes [BR:nfu01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.43  histone-lysine N-methyltransferase
     107397320 (dot1l)
Chromosome and associated proteins [BR:nfu03036]
 Eukaryotic Type
  Histone modification proteins
   HMTs (histone methyltransferases)
    HKMTs (histone lysine methyltransferases)
     107397320 (dot1l)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DOT1 HALZ
Motif
Other DBs
NCBI-GeneID: 107397320
NCBI-ProteinID: XP_015832758
UniProt: A0A1A7ZGK3
LinkDB All DBs
Position
Unknown
AA seq 1609 aa AA seqDB search
MGEKLELKLKSPVGAEPAGYPWPLPVYDKHHDAAHEIIETIRWVCEEIPDLKLAMENYVL
IDYDTKSFESMQRLCDKYNRAIDSIHQLWKGTTQPMKLNKRPSNGLLRHILQQVYNHSVT
DPEKLNNYEPFSPEVYGETSFDLVAQIIDEMEMMEDDTFVDLGSGVGQVVLQVAAATNCK
HYYGVEKADIPATYAETMDKEFKKWMKWYGKKHGEYTLERGDFLSEEWKDRIANTSIIFV
NNFAFGPEVDHQLKERFANMKEGGKIVSSKPFAPLNFRINSRNLSDIGTIMRVVELSPLR
GSVSWTGKPVSYYLHTIDRTILENYFASLKNPKLREEQEAARRRQQKDTKDSKSNSTTPT
KPKEQNKQQDSCGEEEHPSLVTVVKPTAKPRRARLLSKGRKINNKKRGRPKKATTAAEKN
KKNQSALDLLHAKTLSAVPPQDANRPPQSPFYQLPLKAQQYNSSQLLLSPTPPGLQQLLD
NIKVQYLQFLAYMKTPQYRTSLQQLLEQEKQKHRDLSGQAEQLHSVCQSHKDKIKGLFQI
KLDELGVKALTVEDLLQAQKEISAHNCQLKEQTKQLERDMALLRDHSLLLLKSRCEELKL
DWGSLCLESLLKEKQALRRQISEKQKHCLELQISIVELEKSQREHELLQLKSYSPREGSP
YRKTLESRASTDLDSSKLALLSAPTLNGISPELAINGTSSPCFDRANTKVEFSRYLPMSP
DHDIVPASTDARQRQQSSFHALPDYTRFSPAKIALRRHLNQDTGASAHLRGPGLTNHREL
GAVNSAVGVKQNCSSPSAADVQTNPKILERGAKDRSPSVQGDSITSLPISIPLSTVHPSK
LPVLPVSIPLASVVLPSRAERLRSTPSPVAGQTNGYPCSSGLMNGGPYPEDHNGASSSPP
TNGNSPLMGPMGRGGPIQSPSLSTGGVLQYADGPPRILPEDGADRQGGESDTEHQDNELQ
RRMFSSSSSSSSSSSGSVAGGSRLHHHTGNSAKQGYHNNHVNHHHPSPGTQHAHTPTHVS
SVHSLGAQEGRKRGRRKRSSTGAVMATTSPKRRSFPGLGSSSHSSGSPLNINSMVNNINQ
PLEISAISSPEQSNHSPNGPDLDQPPVLKRERPLELNGTGRYSTAPSSDDEDSGYPADSS
SSRIERKIATISLGSRDGHGRLGDIERGRKSGSSSGNSTGSEASSSSSSLSSTSKWKSTF
SPISDPKQPNADLRQGGSPFSTGGSSRGTDSDSDHKQLGRKGSDGDSSSYVTPNPFLGQE
MGARVGSGGAGGVLGGPGSDQRQALLKQKASRDWELKTSSSMASQNLFISAAASSGGGIL
SGKVGGSPVAVSSTTGPSVGPYLGSQFPLGGTSVLQSLFGAQTGVSSVSGTSRLVNGHST
LGSFSSPGLAGGAAGGIFHHVVPSVSSHQFGATLPTSGGLSSLLSLSSSSSTSSQTQQHA
TSQPASTRLTSVTSPLPLFQAQHSRTQSVLHSPSPPTLTLPPPPPLHSVTSTPSAPTHSD
TPASSRSDSLLSPRLSQSSLHHQRVQLSLTLSISSSSSSVSVSTPAAAAAASHPSSLSSS
SSRPFAVHYSPRLPPPPPASSSGGGGSMWRTQSMHGTHTTSQLPGSRPR
NT seq 4830 nt NT seq  +upstreamnt  +downstreamnt
atgggagaaaagctggagctcaagctcaaatcgccagttggagcagaacccgccggctac
ccctggccgttaccagtatacgataaacaccatgatgctgctcatgaaatcattgagacc
attcggtgggtgtgtgaggaaatcccagacctcaaattggcgatggaaaattatgtactc
attgactatgacaccaagagttttgagagtatgcagagactttgtgacaaatacaacagg
gccattgacagcatccaccagttgtggaaggggaccacccagccaatgaagttaaacaag
cgtccttccaacgggctgctgagacacatcttgcagcaggtgtacaaccactcagtgacc
gaccccgagaaactcaacaactatgagcccttctcccctgaggtttatggagaaacctca
ttcgacctggtggctcagatcattgacgagatggaaatgatggaggatgacacttttgtt
gaccttggcagtggagtggggcaggtggtgctgcaggttgcagcagcaaccaactgtaaa
cactactacggcgtggagaaagcagacattccagctacgtatgcagagaccatggacaaa
gagtttaaaaagtggatgaagtggtatgggaagaaacacggggagtacacgctggagaga
ggtgattttctgtctgaagaatggaaagataggattgctaacacaagtattattttcgtg
aataactttgcctttggtccagaggtagatcaccagctgaaggaacgttttgctaatatg
aaggaaggggggaaaattgtgtcctctaaaccttttgcacctttaaattttagaatcaac
agtcgaaacttgagtgatataggcacaataatgcgtgttgtggaactgtctccattaaga
ggctctgtatcctggactggaaagccggtttcttactaccttcataccatagatcgcacc
atacttgaaaactattttgctagtctaaaaaatcctaaactcagggaggagcaagaggca
gctagacggcgtcagcagaaagacacgaaggacagtaaaagcaatagcaccactcctaca
aaacctaaagagcaaaacaagcagcaggactcgtgtggtgaagaggaacatcctagcttg
gtgacggtggtcaagcccactgcaaagcctcggcgagcccggctgttgtccaaaggtcgc
aaaataaacaacaagaaacgcggtcggcccaagaaagccaccactgctgctgagaagaac
aagaagaatcagagcgcgttagatctgctgcacgcaaagaccctttctgcagtgccacct
caggatgcaaacagaccacctcagagtcccttttaccagctacctctcaaggctcagcaa
tataattccagtcaactgctgctgagcccgactcctcctggtctgcagcagctcctcgat
aacatcaaagtccagtacctccagtttttggcctatatgaagactcctcagtatcgcacc
agcctgcagcagcttttagagcaggagaagcaaaaacaccgggacttgtccggccaggcg
gagcagctgcattcggtctgccagtctcacaaagacaagatcaaaggtctattccaaatc
aaactagacgagcttggagtaaaagccctgactgtggaggaccttcttcaggcccagaag
gagatatcagctcacaactgtcagctgaaggagcagacgaagcagcttgagagagacatg
gccttgttgagagaccacagcctgctgctgctcaagtctcgatgtgaggagctgaaactg
gattggggctctttgtgtctggagagtttgttaaaggagaagcaggccttgcgccggcag
atctctgagaaacagaaacattgtttggagctgcagatcagcatcgtagagctggaaaag
agtcagagggagcatgagctgcttcagctcaaatcctacagtcctcgtgagggctccccc
tacaggaagaccctggagtcgcgcgcctccactgatctggactcctcaaagctcgccctg
ttgtctgccccaactctcaatggcattagcccagagcttgctataaatggcaccagctca
ccctgtttcgaccgggcaaacacaaaggtggagttttcccgctacctgcccatgtctcca
gaccacgacattgttcctgccagcactgatgcacgacagcggcagcaaagctctttccac
gcgcttcctgactacacacgcttttctcccgccaagattgccttgcgaaggcaccttaac
caagacactggtgcctccgctcacctgaggggtccagggctgaccaatcacagggaactg
ggagctgtgaactctgcagttggagttaaacaaaactgctcctctcccagtgcagctgac
gttcagactaatcctaagattttggagcggggtgctaaggacaggagtccatcggttcag
ggggacagcatcacaagccttccaatcagcatccctctgagcacggtccatcccagtaag
ctaccagttctaccagtcagcatcccactggccagtgtggtgctgcccagccgagctgag
agacttagaagtactccgagtcctgtggcaggacagaccaatggatatccatgcagctca
gggctaatgaatggaggtccctatcctgaggaccataacggtgcttcttcatcccctccc
actaacggcaacagtcccttgatgggaccaatgggacgaggaggtcccattcagagcccc
tctctgagcaccgggggggtgctccagtatgccgacggacctcccaggattcttccagaa
gatggagcagaccgccaaggtggggaatcagacacggagcatcaagacaatgaactgcag
aggaggatgttctcctcctcttcatcttcgtcttcctcttcatcaggcagcgtggccgga
ggatcacgcctccaccatcacaccggcaactccgccaagcagggctatcacaacaaccac
gtgaaccaccaccacccgtctccgggcacgcagcacgcgcacactcccacacacgtgtca
tctgtgcactcgctcggtgctcaggaggggcgcaagcgaggcaggaggaagcgcagctca
acaggggctgtcatggctactacgtcccccaagaggaggtcattccctggacttggctcc
agcagccactcctcaggatctccactcaacatcaactccatggtaaacaacatcaaccag
cctctggagatctctgccatctcctccccagaacaatcaaaccacagccccaatggtcct
gacctggatcaacccccggttttgaaacgagagcgccccctagagctcaacggcacgggc
cggtactccacagccccaagttctgatgacgaggactcggggtatcccgccgacagctcg
agttctcgaattgaaagaaaaatagccactatatctttggggagcagagacggccacggt
agactgggtgatattgaacgaggcagaaaatcaggtagcagcagcgggaacagcacagga
agtgaggcctcctcctcctcctcctccttgtcctccaccagcaagtggaaatccaccttt
tcacccatttctgatcccaaacagcccaacgctgacctgagacaggggggctctccgttc
agcacgggggggtccagtcggggcacggactcggactcagaccacaaacagctagggagg
aaagggagcgacggggactcttccagctacgtgacccccaatcctttcctcggccaggag
atgggggcgcgagttggaagcgggggtgctggtggagtcctggggggacctggatccgac
caacgccaagccctcctaaagcagaaggcttctcgtgactgggagctgaaaaccagcagc
agcatggccagtcagaatctcttcatttctgctgccgccagcagtggggggggcattctg
agtgggaaggtggggggcagtcctgtagcagtttcttctaccaccgggccatctgtggga
ccgtacctgggctctcagttccctcttggggggacctcagtcttgcagtccctgtttggg
gcccagactggtgtgtccagcgtgagcgggacgtctaggctcgtcaacggacactcgacc
ctgggaagtttctcgtctcctggactggcggggggagcagcaggaggtatatttcaccac
gtggttccctcagtgtcctctcatcagtttggggctacgctgcccacctctggaggcctc
agctcactgctcagtctctcctcctcttcctctacctcttcccaaacccagcaacacgcc
acctcccagccagcctccacgcgcctgacctccgtcacctcccccctccccctgttccag
gcccaacacagccgcacacagtcggtccttcacagcccctctcctcccacgctcacgctg
ccccctcctccccctctgcacagcgtcacctccaccccatctgcacccacgcactctgac
accccagcatcctcccgctcagactccctcctctccccccgcctgtcccagtcctctcta
catcaccagagagtacaactgtccctcacactgtccatctcttcctcatcctcttcagtt
tctgtctctacccctgctgctgctgctgctgcctcacacccctcttctctgtcctcctcc
tcgtctcgtccatttgcagtgcactactcgcctcggctgccccctccacctccagccagc
agctcgggtggtggtgggagcatgtggaggactcagagcatgcatggtacccacaccacc
tcccagctccctggctcccgacctagatag

DBGET integrated database retrieval system