KEGG   Neisseria flavescens: FAH67_00960Help
Entry
FAH67_00960       CDS       T06171                                 

Gene name
sdhA
Definition
(GenBank) succinate dehydrogenase flavoprotein subunit
  KO
K00239  succinate dehydrogenase / fumarate reductase, flavoprotein subunit [EC:1.3.5.1 1.3.5.4]
Organism
nfv  Neisseria flavescens
Pathway
nfv00020  Citrate cycle (TCA cycle)
nfv00190  Oxidative phosphorylation
nfv00650  Butanoate metabolism
nfv01100  Metabolic pathways
nfv01110  Biosynthesis of secondary metabolites
nfv01120  Microbial metabolism in diverse environments
nfv01130  Biosynthesis of antibiotics
nfv01200  Carbon metabolism
Module
nfv_M00009  Citrate cycle (TCA cycle, Krebs cycle)
nfv_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
nfv_M00149  Succinate dehydrogenase, prokaryotes
Brite
KEGG Orthology (KO) [BR:nfv00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    FAH67_00960 (sdhA)
   00650 Butanoate metabolism
    FAH67_00960 (sdhA)
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    FAH67_00960 (sdhA)
Enzymes [BR:nfv01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     FAH67_00960 (sdhA)
    1.3.5.4  fumarate reductase (quinol)
     FAH67_00960 (sdhA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FAD_binding_2 Succ_DH_flav_C Pyr_redox_2 DAO Thi4 FAD_binding_3 GIDA Lycopene_cycl Pyr_redox_3 HI0933_like NAD_binding_8 NAD_binding_7
Motif
Other DBs
NCBI-ProteinID: QCL68142
LinkDB All DBs
Position
172095..173858
Genome map
AA seq 587 aa AA seqDB search
MGFPVRKFDAVIVGGGGAGLRAALQLSKSGLNCAVLSKVFPTRSHTVAAQGGISASLGNV
QEDRWDWHMYDTVKGSDWLGDQDAIEFMCRAAPEAVIELEHMGMPFDRVESGKIYQRPFG
GHTAEHGKRAVERACAVADRTGHAMLHTLYQQNVRANTQFFVEWTAQDLIRDENGDVVGV
TAMEMETGEVYIFHAKAVMFATGGGGRIYASSTNAYMNTGDGLGICARAGIPLEDMEFWQ
FHPTGVAGAGVLITEGVRGEGGILLNADGERFMERYAPTVKDLASRDVVSRAMAMEIYEG
RGCGKNKDHVLLKIDHIGAEKIMEKLPGIREISIQFAGIDPIKDPIPVVPTTHYMMGGIP
TNYHGEVVIPQGEDYEVPVKGLYAAGECACASVHGANRLGTNSLLDLVVFGKAAGDSMIK
FIKEQSDWKPLPANAGELTRQRIERLDNQTGGENVDALRRELQRSVQLHAGVFRTDEILS
KGVREIMEIAKRVKRTEIKDKSKVWNTARIEALELDNLIEVAKATLVSAEARKESRGAHA
SDDHPERDDENWMKHTLYHSDTNTLSYKPVHTKPLSVEYIKPAKRVY
NT seq 1764 nt NT seq  +upstreamnt  +downstreamnt
atgggttttcctgttcgcaagtttgatgccgtgattgtcggcggtggtggtgcaggttta
cgcgcagccctccaattgtctaaatccggcctgaattgtgccgttttgtctaaagtgttt
ccaacccgttctcatactgtagcggctcaaggcggtatttctgcttcattgggtaatgtg
caggaagaccgttgggattggcacatgtacgataccgtgaaaggttctgactggttgggt
gaccaagatgcgattgaatttatgtgtcgcgctgcgcctgaagccgtaattgagttggaa
cacatgggtatgcctttcgaccgtgtggaaagcggtaaaatctaccaacgtcctttcggt
ggccatactgccgaacacggcaaacgcgcggtagagcgtgcatgtgcggttgctgaccgt
accggtcatgcaatgctgcatactttgtaccaacaaaacgtccgtgccaatacacaattc
tttgtggaatggacagcgcaagatttgattcgtgatgaaaacggcgacgtagtcggtgta
accgccatggaaatggaaaccggcgaagtttatattttccacgctaaagctgtaatgttt
gctactggtggtggcggtcgtatttatgcttcttctaccaatgcttatatgaataccggt
gacggtttgggtatttgtgcccgtgcaggtattccgttggaagacatggaattctggcaa
ttccatccgaccggtgtggccggtgcaggtgtattgattaccgagggtgtacgcggtgag
ggcggtattctgctgaatgccgatggcgaacgctttatggaacgttacgctccaaccgta
aaagatttggcttcccgtgacgtggtttcccgtgcgatggcgatggaaatctacgaaggt
cgtggctgtggtaaaaacaaagaccacgtattgctgaaaatcgaccatatcggtgcagaa
aaaattatggaaaaactgccgggcatccgcgagatttccattcagtttgccggtatcgac
ccgattaaagacccgattcctgttgtgccgactacccactacatgatgggcggtattccg
accaactatcatggcgaagttgtcattccgcaaggtgaagattacgaagtgcctgtaaaa
ggtctgtatgcggcaggtgagtgcgcttgtgcttccgtacacggtgcgaaccgcttgggt
accaactccctgcttgacttggtggtgttcggcaaagctgccggcgacagtatgattaaa
ttcatcaaagagcaaagcgactggaaacctctgcctgctaatgccggtgagttgacccgc
caacgtatcgagcgtttggacaaccaaaccggcggcgaaaacgttgatgcattgcgtcgc
gaactgcaacgctccgtacaactgcacgccggtgtgttccgtaccgatgagattctgagc
aaaggcgttcgagaaatcatggagattgccaagcgtgtaaaacgtactgaaatcaaagac
aagagcaaagtatggaataccgcgcgtatcgaagctttggaattggataatctgattgaa
gtagcgaaagcgactttggtgtccgccgaagcgcgtaaagaatcgcgtggtgcacacgct
tcagacgatcatcctgagcgcgatgacgaaaactggatgaaacataccctgtatcattcg
gacaccaataccttgtcttacaaaccggtacacaccaagcctttgagcgtggaatacatc
aaaccggccaagcgcgtttattga

DBGET integrated database retrieval system