KEGG   Nannochloropsis gaditana: NGA_0048202Help
Entry
NGA_0048202       CDS       T02917                                 

Gene name
HADH
Definition
(RefSeq) 3-hydroxyacyl-CoA dehydrogenase
  KO
K02372  3-hydroxyacyl-[acyl-carrier-protein] dehydratase [EC:4.2.1.59]
Organism
ngd  Nannochloropsis gaditana
Pathway
ngd00061  Fatty acid biosynthesis
ngd00780  Biotin metabolism
ngd01100  Metabolic pathways
ngd01212  Fatty acid metabolism
Brite
KEGG Orthology (KO) [BR:ngd00001]
 09100 Metabolism
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    NGA_0048202 (HADH)
  09108 Metabolism of cofactors and vitamins
   00780 Biotin metabolism
    NGA_0048202 (HADH)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:ngd01004]
    NGA_0048202 (HADH)
Enzymes [BR:ngd01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.59  3-hydroxyacyl-[acyl-carrier-protein] dehydratase
     NGA_0048202 (HADH)
Lipid biosynthesis proteins [BR:ngd01004]
 Fatty acid synthase
  Component type
   NGA_0048202 (HADH)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: FabA MaoC_dehydratas 4HBT Img2
Motif
Other DBs
NCBI-GeneID: 17360948
NCBI-ProteinID: XP_005854174
UniProt: K8YU30
LinkDB All DBs
Position
Unknown
AA seq 171 aa AA seqDB search
MADGDAAGAEWRGGQAASAVSKDLKTLLTNENVASILPHRYPFLLVDKVIEMEPGKKAVG
IKQITANEPQFTGHFPERPIMPGVLMVEAMAQLSGVLCLQPPVSDGKGLFFFAGIDGVKF
RKPVVPGDTLVMEVELVKFMESFGIAKLKGKAYVDGDVAVEIKEMTFALSK
NT seq 516 nt NT seq  +upstreamnt  +downstreamnt
atggctgatggtgacgcagctggtgctgagtggcggggtggtcaagcggcgtcagctgta
tcgaaggatctgaaaacgctgctgacgaacgagaatgtcgcgtcgattttgcctcaccga
taccccttcttgctggtggataaagtgattgaaatggagccggggaagaaagctgtgggt
atcaagcaaataacggcaaatgaaccgcagtttacaggtcatttcccagagcgaccaatc
atgcccggagtccttatggtggaggccatggctcagctctcaggcgtgctctgcttgcag
cctcctgtctctgacggcaaaggtctcttcttttttgccggtatcgatggggtcaaattt
cgaaagcctgtggtgccgggggacactctggtcatggaggtggaactggtcaagttcatg
gagtcgtttggcatagccaagctgaaggggaaggcgtacgtcgatggcgacgtggccgtc
gaaatcaaggagatgacttttgccctgtccaagtga

DBGET integrated database retrieval system