KEGG   Natronobacterium gregoryi: Natgr_0070Help
Entry
Natgr_0070        CDS       T02383                                 

Definition
(GenBank) enolase superfamily enzyme related to L-alanine-DL-glutamate epimerase
  KO
K05308  gluconate/galactonate dehydratase [EC:4.2.1.140]
Organism
nge  Natronobacterium gregoryi
Pathway
nge00030  Pentose phosphate pathway
nge00052  Galactose metabolism
nge01100  Metabolic pathways
nge01120  Microbial metabolism in diverse environments
nge01200  Carbon metabolism
Module
nge_M00308  Semi-phosphorylative Entner-Doudoroff pathway, gluconate => glycerate-3P
Brite
KEGG Orthology (KO) [BR:nge00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00030 Pentose phosphate pathway
    Natgr_0070
   00052 Galactose metabolism
    Natgr_0070
Enzymes [BR:nge01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.140  gluconate/galactonate dehydratase
     Natgr_0070
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: MR_MLE_C MR_MLE_N
Motif
Other DBs
NCBI-ProteinID: AFZ71339
UniProt: L0AD32
LinkDB All DBs
Position
70121..71359
Genome map
AA seq 412 aa AA seqDB search
MGVDYADLRDPNAEYTMRDLSAETMQVTRERGGGRDVEITDVQTTMVDGNFPWTLVRIYT
DASIAGTGEAYWGAGAPELIERMAPFLEGENPLDIDRLTEHLVQKMSGEGSIGGVTVTAI
SGIEVALHDLVGKILEVPAYQLLGGKYRDEVRVYCDCHTEAEADPIACADEAERVVDELG
YDALKFDLDVPSGHEKDRANRHLRSPEIEHKTSIVEAVTQRVGSRADVAFDCHWTFSGGS
AKRLAKRLEEYDVWWLEDPVPPENHDVQREVTQSTTTPVAAGENVYRTHGQRRLLEEQAV
DIIAPDMPKVGGMRETRKIADLADLYYVPVAMHNVASPVATMGSVHVGAAISNTLAVEYH
SYELGWWEDLVEEDVIEDGYIEVPEEPGLGVTLDMDVVEEQMVEGEELFDEA
NT seq 1239 nt NT seq  +upstreamnt  +downstreamnt
atgggagtcgattacgcggatctacgcgacccgaacgcggagtatacgatgcgagatctc
tccgcggagacgatgcaagtcactcgcgagcgcgggggtggacgggacgtcgagattacg
gacgtccagacgacgatggtcgacggcaacttcccgtggacgctggttcggatctacacc
gacgccagcatcgccggcaccggggaagcctactggggtgcgggcgcgcccgaactgatc
gagcgaatggcaccgtttctcgagggcgagaacccactcgacatcgaccgtctcacggag
catctcgtccagaagatgtccggcgagggctcgatcggcggcgtcaccgtcaccgcgatc
tcgggcatcgaagtcgcactgcacgacctcgtgggcaagatcctcgaggtaccggcctat
cagttgctcggtggcaagtaccgcgacgaagtgcgggtctactgtgactgtcacaccgaa
gcagaagccgatccgatcgcctgtgcggacgaggccgaacgcgtcgtcgacgaactcggc
tacgacgcactcaaattcgacctcgacgtcccctccggccacgagaaagatcgtgccaac
cgccatctacgttcacccgagatcgaacacaagacgagcatcgtcgaagccgtcacccaa
cgcgtcggctcgcgggccgacgtcgccttcgactgtcactggacgttctcgggtggctcc
gcgaaacgactcgcaaagcgcctcgaggagtacgacgtctggtggctcgaggacccagtg
ccgccggagaatcacgacgtccagcgcgaggtcacccagtcgacgacgaccccggttgcg
gccggcgagaacgtctaccgcactcacgggcagcgccggctactcgaggagcaggcagtc
gacattattgcaccggacatgcccaaggtcggcgggatgcgagaaacccggaagattgcc
gatctggccgatctctactacgttccggtggcgatgcacaacgtcgcctcgccggtcgcg
acgatgggcagcgtccacgtcggcgcggcgatttcgaacacgctcgcggtggagtaccac
tcctacgaactcggctggtgggaggatctcgtcgaggaagacgtcatcgaggacggctac
atcgaggttcccgaagagccgggactgggggtgacgctggatatggacgtcgtcgaggag
cagatggtcgagggtgaggaactcttcgacgaagcgtag

DBGET integrated database retrieval system