KEGG   Natronobacterium gregoryi: Natgr_0356Help
Entry
Natgr_0356        CDS       T02383                                 

Definition
(GenBank) malic enzyme
  KO
K00029  malate dehydrogenase (oxaloacetate-decarboxylating)(NADP+) [EC:1.1.1.40]
Organism
nge  Natronobacterium gregoryi
Pathway
nge00620  Pyruvate metabolism
nge01100  Metabolic pathways
nge01120  Microbial metabolism in diverse environments
nge01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:nge00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    Natgr_0356
Enzymes [BR:nge01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.40  malate dehydrogenase (oxaloacetate-decarboxylating) (NADP+)
     Natgr_0356
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PTA_PTB malic Malic_M HTH_31
Motif
Other DBs
NCBI-ProteinID: AFZ71613
UniProt: L0ACK2
LinkDB All DBs
Position
complement(356222..358477)
Genome map
AA seq 751 aa AA seqDB search
MGLDEDSLDYHRTDPPGKIEISTTKSTNTQRDLSLAYSPGVAAPCMEIDEEEDEAYTYTA
KGNLVGVVSNGSAVLGLGDIGAQASKPVMEGKGVLFKRFADIDVFDVELDEADPHKFVEA
VKMMEPTFGGINLEDIKAPECFTIEERLREETDIPVFHDDQHGTAIISGAALLNAADVAD
KDLEDLEIVFSGAGASAIATAKFYVSLGCRKENVTMCDSSGIITEERAENGELNEYKRQF
ARDVPEGDLADAMEGADVFVGLSIGGIVSQQMIQSMADDPIVFAMANPDPEIGYEEAKEA
RDDTVIMATGRSDYPNQVNNVLGFPFIFRGALDVRATEINEAMKVACAEALAELAREDVP
DAVVKAYGDEPLQFGSDYIIPKPVDPRVLFRVAPAVAEAAIESGAARTEIDPDEYEEELE
ARLGKSREMMRVVLNKAKTDPKTVALAEGENEKIIRAAYQIQEQGIAAPILIGDESEIRQ
TAANLGLDFEPQVADPAVGDYEEYADRLHELRARKGITRTEAGDLIERDSNYFGTVMVEQ
GDADALLTGLSYHYPSALRPPLQVIGTADDVDYAAGVYMLTFKNRVVFVADATVNQDPDE
EVLAEVTRLTGELARRFNVEPRAALLSYSNFGSVDNQGTRKPRRAAHMLQDDPEVDFPVD
GEMQADTAVVEDILQGTYGFSELEEPANVLVFPNLESGNIGYKLLQRLGGADAIGPMLVG
MDKPVHVLQRGDEVKDIVNLASVAVVDAQQE
NT seq 2256 nt NT seq  +upstreamnt  +downstreamnt
atgggactagacgaggattcactcgactaccaccggacagaccctcccggaaagatcgag
atctcgacgacgaaatcgacgaacacgcagcgtgatctctcgcttgcgtactcgcccggc
gtcgcagcgccgtgtatggagatcgacgaagaggaagacgaagcctacacctacactgca
aaggggaacctcgtcggcgtcgtctcgaacgggtccgccgttctcggcctcggcgacatc
ggtgcccaggcatccaagcccgtcatggaaggaaaaggcgtactcttcaagcggttcgcc
gatatcgacgtcttcgacgtggaactcgacgaggcagaccctcacaagttcgtcgaagcc
gtcaagatgatggaaccgaccttcggcggaatcaacttggaggacatcaaggccccggag
tgtttcaccatcgaggagcgactccgcgaggagaccgacattccggtgttccacgacgat
cagcacggcaccgcgatcatctccggcgcggcactgctcaacgccgccgacgtcgccgac
aaagacctcgaggacctcgagatcgtcttctccggtgcaggggcgagcgcgatcgcgact
gcgaagttttacgtctcgcttggctgcaggaaagagaacgtcacgatgtgtgactcttcg
ggaatcatcaccgaagaacgggccgagaacggcgaactcaacgagtacaaacgacagttc
gcccgcgacgtccccgaaggtgatctcgcggacgcaatggagggtgcagacgtcttcgtc
ggcctctcgatcggcgggatcgtctcacagcagatgatccagtcgatggcggacgatccg
atcgtcttcgcgatggccaaccccgatccggagatcggctacgaggaggcaaaggaggcc
cgcgacgacaccgtcatcatggccaccggccgctccgactaccccaaccaggtcaacaac
gtcctcgggttccccttcatcttccgtggggcactcgacgtccgtgccaccgagatcaac
gaggcgatgaaagtcgcctgtgcagaggcactcgccgaactcgcccgcgaagacgttccc
gacgccgtcgtgaaagcctacggcgacgaaccgctccagttcggctccgactacatcatc
ccgaagccagtcgatccacgggttctctttcgcgtcgcacccgcagtcgccgaggccgcg
atagaatctggtgccgcccgaaccgagatcgatcccgacgaatacgaggaggaactcgag
gcccgtctcggcaagtcccgcgagatgatgcgcgtggtcctcaacaaggccaagaccgat
ccgaagacggtcgcgctcgcggaaggcgaaaacgagaagatcattcgggcggcctaccag
atccaggagcaaggaatcgccgcaccgatcctcatcggcgacgagagcgagatccgccag
acggcggcgaatctcggcctcgacttcgagccacaggtcgccgacccagccgtcggcgac
tacgaggagtacgccgatcggctccacgaactgcgggcacgaaagggcatcacccgaacc
gaggccggtgacctcatcgaacgcgactcgaactacttcggcaccgtcatggtcgaacaa
ggcgacgccgacgccctgctgaccggtctctcgtatcactacccgtcggcgctgcgaccg
ccactgcaggtcatcggcaccgccgacgacgtcgactacgccgctggcgtctacatgctc
acgttcaagaaccgcgtcgtcttcgtcgccgacgcgacggtcaatcaggaccccgacgag
gaggtcctcgcagaagtcacgcggttgactggcgagctcgcccgacggttcaacgtcgaa
ccgcgtgcggccctgctgtcgtactcgaacttcggcagcgtcgacaaccagggcacccgt
aaaccccgccgcgctgcacacatgctgcaggacgaccccgaagtcgacttccccgtcgac
ggcgagatgcaggccgacaccgctgtcgtcgaagacatcctccagggaacgtacggcttc
tcggaactcgaggagcccgcaaacgtactcgtattcccgaacctcgagtcgggtaacatc
ggctacaagctgctccagcgtctgggcggtgccgacgccatcgggccgatgctcgtgggg
atggacaagccggtccacgtcctccagcgcggagacgaggtcaaagacatcgtgaacctg
gcgagcgtggcggtcgtcgacgcccaacaggagtaa

DBGET integrated database retrieval system