KEGG   Novosphingobium ginsenosidimutans: FRF71_11835Help
Entry
FRF71_11835       CDS       T06189                                 

Definition
(GenBank) aminodeoxychorismate/anthranilate synthase component II
  KO
K01658  anthranilate synthase component II [EC:4.1.3.27]
Organism
ngf  Novosphingobium ginsenosidimutans
Pathway
ngf00400  Phenylalanine, tyrosine and tryptophan biosynthesis
ngf01100  Metabolic pathways
ngf01110  Biosynthesis of secondary metabolites
ngf01130  Biosynthesis of antibiotics
ngf01230  Biosynthesis of amino acids
ngf02024  Quorum sensing
Module
ngf_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:ngf00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    FRF71_11835
  09110 Biosynthesis of other secondary metabolites
   00405 Phenazine biosynthesis
    FRF71_11835
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    FRF71_11835
Enzymes [BR:ngf01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.3  Oxo-acid-lyases
    4.1.3.27  anthranilate synthase
     FRF71_11835
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GATase Peptidase_C26
Motif
Other DBs
NCBI-ProteinID: QEA16764
UniProt: A0A5B8S6F0
LinkDB All DBs
Position
complement(2398511..2399095)
Genome map
AA seq 194 aa AA seqDB search
MILVIDNYDSFTWNLVHYLMELGAAVEVVRNDALSAGQAVSSGAQGFLISPGPCTPNEAG
ISLDLVGACADAGKPLLGVCLGHQSIGQYFGGKVVRGGLMHGKTSPVTHDRTGLFKGLPS
PFTATRYHSLIVEDIPDSLVVNARSDDGHVMGFRHAHLPIHGVQFHPESIATEHGHAMLA
NFLGLCGIKAKELA
NT seq 585 nt NT seq  +upstreamnt  +downstreamnt
atgatcctcgttatcgataactacgacagcttcacctggaacctagtccattacctgatg
gaactgggcgccgcggttgaagtcgtgcgcaatgatgcgctgtcggcggggcaagcggtc
agcagcggtgcgcagggcttcctgatctcgcccggcccctgcaccccgaacgaagccggg
atcagcctggacctggtcggtgcctgcgccgatgccggcaaacccctgctcggcgtctgc
ctggggcaccagtcgatcggccagtatttcggcggcaaggtggtgcgcggcgggctgatg
cacggcaagacttcacccgtgacccacgatcgcaccgggctgttcaagggcctgccctcg
cccttcaccgcaacccgctatcactcgctgatcgtcgaggacattccggacagtctcgta
gtcaacgcccgctcggatgacggccatgtcatgggcttccgccatgcgcatctgccgatc
cacggcgtgcagttccaccccgagtccatcgccaccgagcatggacacgccatgctggcg
aatttccttggcctctgcggtatcaaggcgaaggaactggcgtga

DBGET integrated database retrieval system