KEGG   Neorhizobium galegae bv. orientalis HAMBI 540: RG540_CH01320Help
Entry
RG540_CH01320     CDS       T03244                                 

Definition
(GenBank) Glycerol-3-phosphate dehydrogenase
  KO
K00111  glycerol-3-phosphate dehydrogenase [EC:1.1.5.3]
Organism
ngg  Neorhizobium galegae bv. orientalis HAMBI 540
Pathway
ngg00564  Glycerophospholipid metabolism
ngg01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:ngg00001]
 Metabolism
  Lipid metabolism
   00564 Glycerophospholipid metabolism
    RG540_CH01320
Enzymes [BR:ngg01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.5  With a quinone or similar compound as acceptor
    1.1.5.3  glycerol-3-phosphate dehydrogenase
     RG540_CH01320
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DAO DAO_C Pyr_redox_2 NAD_binding_8 FAD_oxidored GIDA FAD_binding_2 STPPase_N 3HCDH_N
Motif
Other DBs
NCBI-ProteinID: CDN46327
UniProt: A0A068SJT4
LinkDB All DBs
Position
complement(130392..131906)
Genome map
AA seq 504 aa AA seqDB search
MGEEIHDIFVIGGGINGCGIARDAAGRGYSVALAEMDDFASGTSSGATKLIHGGLRYLEH
YEFRLVRESLMERETLWAMAPHIIWPLRFVLPYHKGGIRPAWLIRLGLFLYDHLGGRKLL
PPTAVLDMRTDPAGKPLKPLFTKAFEYSDGWVDDARMVVLNARDAADRGALILPRTRVVA
ARREGGLWMIETVGTSTGRAETYKARMLVNAAGPWVDQVIREALGNNDARHVRLVQGSHI
VVKKKFEGSRAYFFQNRDNRIIFAIPYENDFTLIGTTDRDYSGNPKDVKISEEETTYLCN
AASEYFRESVRPADIVWTYSAVRPLFDDGASKAQEATRDYVLKLDDTQGAPLLNVFGGKL
TTYRRLSEHALEKIAEAIGAKGRPWTAKSHLPGGDFAAQGYEQEVAKLKARYPFLEERHA
RRLVRRYGTRAGMILDRAAKMEDLGHHFGGDLYEAEVKYLIDREWAMSAQDVLWRRTKDG
LRLSETEKEYLEEYMAAVPAKMAG
NT seq 1515 nt NT seq  +upstreamnt  +downstreamnt
atgggcgaggaaatccacgacatcttcgtgatcggcggcggcatcaacggctgcggcatt
gcacgtgatgcggccgggcgcggttattccgttgcgcttgcggagatggacgattttgcc
tcgggcacctcttccggcgccaccaaactcatccatggcggcctgcgttatctcgaacat
tacgaattcaggctggtgcgggaatcgctgatggagcgcgaaaccctctgggcgatggca
ccgcacatcatttggccgctgcgcttcgtcctgccataccacaagggcggcatccgcccg
gcatggctgatccggctgggcctgtttctctacgaccatctcggcggtcgaaagctgctg
ccgccgaccgccgtgctggacatgcgcaccgacccggccgggaagcctctgaagccgctt
ttcaccaaggcattcgaatattccgacggctgggtcgacgatgcccggatggtggtgctg
aacgcccgggatgcagccgatcgcggtgctttgatcctgccgcgcacccgggtggttgcc
gctcgtcgggaaggcggcctctggatgatcgaaacagtcggcaccagcacgggacgggca
gagacctacaaggcccgcatgctggtgaatgctgcaggtccctgggtggatcaggtaatc
cgcgaggcgctcggcaacaatgacgcccgccatgtgcgccttgtccagggcagccatatc
gtggtgaaaaagaagttcgaaggatcccgggcctatttctttcagaaccgggacaatcgc
atcattttcgcgatcccttacgaaaacgacttcacccttatcggtacgaccgaccgggac
tattccggcaatccgaaagacgtgaaaatctccgaagaggagacgacctatctctgcaat
gctgcgagcgagtattttcgggagtcggtccggccggcagacattgtctggacctattcg
gcggttcgcccgcttttcgacgacggtgcctcaaaggcgcaggaagcaacgcgcgactat
gtgctgaagctcgacgacacccagggtgcgccgttgctcaacgtgttcggcggcaagctg
accacctatcgccggctttcggaacatgcgctcgagaagatcgccgaagcgatcggagca
aagggccggccctggacggcgaagagccacctgccgggcggcgattttgcggcccaaggt
tacgagcaagaagtagcgaaactcaaggcccgctatccatttctggaggaacggcatgcg
cggcgactggtgcgccggtatggaacccgcgccgggatgatcctcgacagggcggccaag
atggaggatcttggtcaccacttcggcggcgatctctacgaggccgaggtcaaatatctt
atcgaccgtgaatgggccatgagtgcgcaggacgtgctctggcggagaaccaaagacggt
ttgcggctgagcgaaactgagaaagagtatctggaggagtacatggctgctgtcccggca
aaaatggccggataa

DBGET integrated database retrieval system