KEGG   Neorhizobium galegae bv. orientalis HAMBI 540: RG540_CH07640Help
Entry
RG540_CH07640     CDS       T03244                                 

Definition
(GenBank) Superoxide dismutase
  KO
K04564  superoxide dismutase, Fe-Mn family [EC:1.15.1.1]
Organism
ngg  Neorhizobium galegae bv. orientalis HAMBI 540
Brite
Enzymes [BR:ngg01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     RG540_CH07640
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sod_Fe_C Sod_Fe_N
Motif
Other DBs
NCBI-ProteinID: CDN46953
UniProt: A0A068SL88
LinkDB All DBs
Position
759101..759703
Genome map
AA seq 200 aa AA seqDB search
MAFELPELPYDYEALSPFMSKETLEFHHDKHHKAYVDNGNKLAAEAGMADLSVEEVVKKS
FGTNQGLFNNAAQHYNHVHFWKWMKKGGGGTKLPGKLEAAVASDLGGYDKFKADLIAAGT
TQFGSGWAWLSVKDGKLVISKTPNGENPLVHGAEPILGVDVWEHSYYIDYRNARPKYLEA
FVDSLINWDYVLERYEAATK
NT seq 603 nt NT seq  +upstreamnt  +downstreamnt
atggctttcgaacttcccgaactcccctacgactacgaagccctttcgcccttcatgtcg
aaagagacgctcgaattccaccacgacaagcaccacaaggcttatgtcgacaacggcaac
aagctcgctgccgaagccggaatggccgatctgtcggtcgaggaagtcgtcaagaaatcc
ttcggcaccaaccagggcctcttcaacaacgctgcccagcattacaaccatgtccatttc
tggaagtggatgaagaagggcggcggcggcaccaagctgccgggcaagctcgaggcggca
gtcgcctccgatctcggcggctacgacaagttcaaggctgacctgatcgccgccggcacc
acccagttcggctccggctgggcctggctttccgtaaaagacggtaagctcgtcatctcc
aagaccccgaacggcgagaacccgctggttcacggcgcagagccgatcctcggcgtcgac
gtctgggaacattcctattacatcgactaccgcaacgcccgcccgaaatacctcgaagcc
ttcgtcgatagcctgatcaactgggactacgtcctcgaacgctacgaagccgccacgaag
taa

DBGET integrated database retrieval system