KEGG   Neorhizobium galegae bv. orientalis HAMBI 540: RG540_CH12890Help
Entry
RG540_CH12890     CDS       T03244                                 

Definition
(GenBank) Translation elongation factor Tu
  KO
K02358  elongation factor Tu
Organism
ngg  Neorhizobium galegae bv. orientalis HAMBI 540
Brite
KEGG Orthology (KO) [BR:ngg00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03012 Translation factors [BR:ngg03012]
    RG540_CH12890
   03029 Mitochondrial biogenesis [BR:ngg03029]
    RG540_CH12890
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:ngg04147]
    RG540_CH12890
Translation factors [BR:ngg03012]
 Eukaryotic Type
  Elongation factors
   RG540_CH12890
 Prokaryotic Type
   RG540_CH12890
Mitochondrial biogenesis [BR:ngg03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Mitochondrial translation factors
    RG540_CH12890
Exosome [BR:ngg04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   RG540_CH12890
  Exosomal proteins of breast cancer cells
   RG540_CH12890
  Exosomal proteins of colorectal cancer cells
   RG540_CH12890
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GTP_EFTU GTP_EFTU_D3 GTP_EFTU_D2 MMR_HSR1 RsgA_GTPase cobW
Motif
Other DBs
NCBI-ProteinID: CDN47470
UniProt: A0A068SMN1
LinkDB All DBs
Position
1246433..1247608
Genome map
AA seq 391 aa AA seqDB search
MAKSKFERNKPHVNIGTIGHVDHGKTSLTAAITKYFGEYKAYDQIDAAPEEKARGITIST
AHVEYETTARHYAHVDCPGHADYVKNMITGAAQMDGAILVCSAADGPMPQTREHILLARQ
VGVPAIVVFLNKVDQVDDAELLELVELEVRELLSSYDFPGDDIPIIKGSALAALEDSDKK
IGEDSIRELMAAVDAYIPTPERPINLPFLLPIEDVFSISGRGTVVTGRVERGIVKVGEEV
EIVGIRATTKTTVTGVEMFRKLLDQGQAGDNIGALIRGVQRDGVERGQILCKPGSVKPHT
VFMAEAYILTKEEGGRHTPFFTNYRPQFYFRTTDVTGIVELPEGTEMVMPGDNVTVKVTL
INPIAMEEKLRFAIREGGRTVGAGIVASIVE
NT seq 1176 nt NT seq  +upstreamnt  +downstreamnt
atggcaaagagcaagtttgagcgcaacaagccgcacgtcaacattggcacgatcggtcac
gttgaccatggcaagacgtcgctgacggccgcgatcacgaagtacttcggcgagtacaag
gcctatgaccagatcgacgcggctcctgaagaaaaggcacgcggcatcaccatttcgacg
gcgcacgtcgaatatgagacgactgcccgccactatgcgcacgtcgactgccccggccac
gccgactatgtgaagaacatgatcaccggtgcggcgcagatggacggcgcgatcctggtt
tgctcggctgccgatggcccgatgccgcagacccgcgagcacatcctgctcgcccgtcag
gtcggcgttccggcaatcgtggtgttcctgaacaaggttgaccaggtcgacgacgccgag
cttctcgagctcgtcgaactggaagtgcgcgaacttctgtcgtcctacgacttcccgggc
gacgacattccgatcatcaagggttcggcgctggccgctcttgaagattcggacaagaag
atcggcgaagattcgatccgcgaactgatggccgctgtcgacgcctacatcccgacgcct
gagcgtccgatcaacctgccgttcctgctgccgatcgaagacgtgttctcgatctcgggc
cgtggtacggtcgtgaccggccgcgtcgagcgtggcatcgtcaaggttggcgaagaagtc
gagatcgtcggcatccgcgccaccaccaagacgacggtgaccggcgttgaaatgttccgc
aagctgctcgaccagggtcaggccggcgacaatatcggcgctctgatccgtggcgtccag
cgtgacggcgtcgagcgtggccagatcctgtgcaagccgggttcggtcaagccgcacacg
gtgttcatggcagaagcctatatcctgacgaaggaagaaggcggtcgtcatacgccgttc
ttcaccaactaccgtccgcagttctacttccgcacgacggacgtgacgggcatcgtcgaa
cttccggaaggcacggaaatggtcatgcctggcgacaacgtgaccgttaaggtgacgctg
atcaacccgatcgcgatggaagaaaagctgcgcttcgcgatccgcgaaggcggccgtacc
gtcggcgccggcatcgtcgcttcgatcgtcgagtaa

DBGET integrated database retrieval system