KEGG   Neorhizobium galegae bv. orientalis HAMBI 540: RG540_CH18690Help
Entry
RG540_CH18690     CDS       T03244                                 

Definition
(GenBank) Phosphoribosyl-AMP cyclohydrolase
  KO
K01496  phosphoribosyl-AMP cyclohydrolase [EC:3.5.4.19]
Organism
ngg  Neorhizobium galegae bv. orientalis HAMBI 540
Pathway
ngg00340  Histidine metabolism
ngg01100  Metabolic pathways
ngg01110  Biosynthesis of secondary metabolites
ngg01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:ngg00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00340 Histidine metabolism
    RG540_CH18690
Enzymes [BR:ngg01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.4  In cyclic amidines
    3.5.4.19  phosphoribosyl-AMP cyclohydrolase
     RG540_CH18690
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PRA-CH
Motif
Other DBs
NCBI-ProteinID: CDN48039
UniProt: A0A068SQ94
LinkDB All DBs
Position
1820433..1820894
Genome map
AA seq 153 aa AA seqDB search
MSFSFDQPSADKTELEGAGAFTPRFDQNGLVTAVVTDVRDGELLMVAHMDAEALALTVET
GIAHYYSRSRAKIWKKGESSGNLQTVHELRTDCDQDAVWLKVSVAGHDATCHTGRRSCFY
RTVTQSDGRAVLEITDNQRHFDPNVVYSDQGTI
NT seq 462 nt NT seq  +upstreamnt  +downstreamnt
atgtcgttttcttttgaccagccttccgccgacaagacggaactcgaaggcgctggcgcc
ttcacgccccgcttcgatcagaacggcctcgtcaccgccgtcgtcaccgatgtccgtgac
ggcgaactgttgatggtcgcgcatatggacgccgaagcgctggcgctgacggtcgagacc
ggcattgcgcattactacagccgctcgcgtgccaaaatctggaagaagggcgaatcctcc
ggcaacctgcagactgtccatgaactgcgcaccgactgcgaccaggacgccgtctggctc
aaggtctcggtcgcgggacacgacgctacatgccataccggccgtcgctcctgtttctat
cggactgttacccaaagtgatggtagggcggttcttgaaatcaccgacaatcagcgtcat
tttgatccaaatgtcgtctattccgatcaaggaaccatttag

DBGET integrated database retrieval system